DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ van-2010-20 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined van den Elzen AM., Henri J., Lazar N., Gas ME., Durand D., Lacroute F., Nicaise M., van Tilbeurgh H., Séraphin B., Graille M. DIP original experiment: DIP-216290X Nature structural & molecular biology 2010 IMEx Dissection of Dom34-Hbs1 reveals independent functions in two RNA quality control pathways. van den Elzen AM., Henri J., Lazar N., Gas ME., Durand D., Lacroute F., Nicaise M., van Tilbeurgh H., Séraphin B., Graille M. Only protein-protein interactions imex curation van-2010-21 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined van den Elzen AM., Henri J., Lazar N., Gas ME., Durand D., Lacroute F., Nicaise M., van Tilbeurgh H., Séraphin B., Graille M. DIP original experiment: DIP-216292X Nature structural & molecular biology 2010 IMEx Dissection of Dom34-Hbs1 reveals independent functions in two RNA quality control pathways. van den Elzen AM., Henri J., Lazar N., Gas ME., Durand D., Lacroute F., Nicaise M., van Tilbeurgh H., Séraphin B., Graille M. Only protein-protein interactions imex curation van-2010-22 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined van den Elzen AM., Henri J., Lazar N., Gas ME., Durand D., Lacroute F., Nicaise M., van Tilbeurgh H., Séraphin B., Graille M. DIP original experiment: DIP-216291X Nature structural & molecular biology 2010 IMEx Dissection of Dom34-Hbs1 reveals independent functions in two RNA quality control pathways. van den Elzen AM., Henri J., Lazar N., Gas ME., Durand D., Lacroute F., Nicaise M., van Tilbeurgh H., Séraphin B., Graille M. Only protein-protein interactions imex curation hbs1_yeast Elongation factor 1 alpha-like protein HBS1 YKR404 YKR084C protein protein yeast Saccharomyces cerevisiae Baker's yeast MAYSDYSDGADDMPDFHDEGEFDDYLNDDEYDLMNEVFPTLKAQLQDYQGWDNLSLKLALFDNNFDLESTLAELKKTLKKKKTPKKPIAAANGSANVTQKLANISISQQRPNDRLPDWLDEEESEGERNGEEANDEKTVQRYYKTTVPTKPKKPHDISAFVKSALPHLSFVVLGHVDAGKSTLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEERERGVTVSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFESGFDLDGQTKEHMLLASSLGIHNLIIAMNKMDNVDWSQQRFEEIKSKLLPYLVDIGFFEDNINWVPISGFSGEGVYKIEYTDEVRQWYNGPNLMSTLENAAFKISKENEGINKDDPFLFSVLEIIPSKKTSNDLALVSGKLESGSIQPGESLTIYPSEQSCIVDKIQVGSQQGQSTNHEETDVAIKGDFVTLKLRKAYPEDIQNGDLAASVDYSSIHSAQCFVLELTTFDMNRPLLPGTPFILFIGVKEQPARIKRLISFIDKGNTASKKKIRHLGSKQRAFVEIELIEVKRWIPLLTAHENDRLGRVVLRKDGRTIAAGKISEITQ 11EC2CB6936396EE dom34_yeast Protein DOM34 N2016 YNL001W DOM34 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKVISLKKDSFNKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFTSKLDEAGKKKSTDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIEYSMPKKKRTTDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDEDDGEE 4E8B7D9BBCD60888 dom34-hbs1-5 3218038 N/A 3218041 unspecified role unspecified role unspecified role unspecified role Region 135-610 Region 135-610 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3218042 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dom34-hbs1-6 3218039 N/A 3218041 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3218042 unspecified role unspecified role bait bait P33309:p.[Tyr300Ala;Glu361Ala] Y300A/E361A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P33309:p.Glu361Arg E361R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P33309:p.[Glu361Ala;Gln364Ala] E361A/Q364A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P33309:p.[Lys174Ala;Lys175Ala;Lys176Ala;Arg177Ala] K174A/K175A/K176A/R177A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P33309:p.[Ser215Ala;Pro216Ala;Phe218Ala] S215A/P216A/F218A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false dom34-hbs1-7 3218040 N/A 3218041 unspecified role unspecified role prey prey P32769:p.Arg517Glu R517E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P32769:p.Leu520Arg L520R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P32769:p.[Arg557Ala;His558Ala] R557A/H558A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P32769:p.[Arg256Ala;Asp257Ala;Phe258Ala] R256A/D257A/F258A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3218042 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false