DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ housden-2010-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. DIP original experiment: DIP-220650X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. Only protein-protein interactions imex curation housden-2010-2 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. DIP original experiment: DIP-220653X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. Only protein-protein interactions imex curation housden-2010-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. DIP original experiment: DIP-220651X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. Only protein-protein interactions imex curation housden-2010-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. DIP original experiment: DIP-220654X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. Only protein-protein interactions imex curation housden-2010-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. DIP original experiment: DIP-220652X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF. Housden NG., Wojdyla JA., Korczynska J., Grishkovskaya I., Kirkpatrick N., Brzozowski AM., Kleanthous C. Only protein-protein interactions imex curation cea9_ecolx Colicin-E9 col cei protein protein ecolx Escherichia coli MSGGDGRGHNTGAHSTSGNINGGPTGIGVSGGASDGSGWSSENNPWGGGSGSGIHWGGGSGRGNGGGNGNSGGGSGTGGNLSAVAAPVAFGFPALSTPGAGGLAVSISASELSAAIAGIIAKLKKVNLKFTPFGVVLSSLIPSEIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSVPVVDAKPTERPGVFTASIPGAPVLNISVNDSTPAVQTLSPGVTNNTDKDVRPAGFTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSAAQERRKQKENKEKDAKDKLDKESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKSFDDFRKAVWEEVSKDPELSKNLNPSNKSSVSKGYSPFTPKNQQVGGRKVYELHHDKPISQGGEVYDMDNIRVTTPKRHIDIHRGK ompf_ecoli Outer membrane porin F ompF cmlB tolF coa cry Porin OmpF Outer membrane protein 1A Outer membrane protein IA Outer membrane protein B b0929 JW0912 Outer membrane protein F protein protein ecoli Escherichia coli (strain K12) MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF 3F0974D96DB65464 col-ompf-1 3217993 N/A 3217998 unspecified role unspecified role unspecified role unspecified role Region 2-18 Region 2-18 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3217999 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false col-ompf-2 3217994 N/A 3217998 unspecified role unspecified role unspecified role unspecified role Region 2-18 Region 2-18 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 54-63 Region 54-63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3217999 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false col-ompf-3 3217995 N/A 3217998 unspecified role unspecified role unspecified role unspecified role Region 1-347 Region 1-347 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217999 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false col-ompf-4 3217996 N/A 3217998 unspecified role unspecified role unspecified role unspecified role Region 1-347 Region 1-347 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 1-83 Region 1-83 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 1-8 Region 1-8 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217999 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ompf-2 3217997 N/A 3217999 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false