DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ he-2010-17 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western He W., Zhang L., Ni A., Zhang Z., Mirotsou M., Mao L., Pratt RE., Dzau VJ. DIP original experiment: DIP-220629X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Exogenously administered secreted frizzled related protein 2 (Sfrp2) reduces fibrosis and improves cardiac function in a rat model of myocardial infarction. He W., Zhang L., Ni A., Zhang Z., Mirotsou M., Mao L., Pratt RE., Dzau VJ. Only protein-protein interactions imex curation he-2010-18 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined He W., Zhang L., Ni A., Zhang Z., Mirotsou M., Mao L., Pratt RE., Dzau VJ. DIP original experiment: DIP-220630X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Exogenously administered secreted frizzled related protein 2 (Sfrp2) reduces fibrosis and improves cardiac function in a rat model of myocardial infarction. He W., Zhang L., Ni A., Zhang Z., Mirotsou M., Mao L., Pratt RE., Dzau VJ. Only protein-protein interactions imex curation sfrp2_mouse Secreted frizzled-related protein 2 Sfrp2 Sarp1 Sdf5 Protein SDF5 Secreted apoptosis-related protein 1 protein protein mouse Mus musculus Mouse MPRGPASLLLLVLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC p13497-2 Bone morphogenetic protein 1 BMP1 PCOLC Mammalian tolloid protein Procollagen C-proteinase protein protein human Homo sapiens Human MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSEKRPALQPPRGRPHQLKFRVQKRNRTPQ sfrp2-bmp1-1 3217787 N/A 3217789 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3217790 unspecified role unspecified role prey prey Region 121-730 Region 121-730 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse physical association physical association false false false bmp1-sfrp2-1 3217788 N/A 3217789 unspecified role unspecified role unspecified role unspecified role Region 25-295 Region 25-295 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3217790 unspecified role unspecified role unspecified role unspecified role Region 121-730 Region 121-730 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse direct interaction direct interaction false false false