DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ma-2010-3 in vitro In vitro pull down pull down de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. DIP original experiment: DIP-217207X Structure (London, England : 1993) 2010 IMEx Phosphorylation of DCC by ERK2 is facilitated by direct docking of the receptor P1 domain to the kinase. Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. Only protein-protein interactions imex curation ma-2010-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. DIP original experiment: DIP-217209X Structure (London, England : 1993) 2010 IMEx Phosphorylation of DCC by ERK2 is facilitated by direct docking of the receptor P1 domain to the kinase. Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. Only protein-protein interactions imex curation ma-2010-5 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. DIP original experiment: DIP-217216X Structure (London, England : 1993) 2010 IMEx Phosphorylation of DCC by ERK2 is facilitated by direct docking of the receptor P1 domain to the kinase. Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. Only protein-protein interactions imex curation ma-2010-6 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. DIP original experiment: DIP-217212X Structure (London, England : 1993) 2010 IMEx Phosphorylation of DCC by ERK2 is facilitated by direct docking of the receptor P1 domain to the kinase. Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. Only protein-protein interactions imex curation ma-2010-7 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. DIP original experiment: DIP-217214X Structure (London, England : 1993) 2010 IMEx Phosphorylation of DCC by ERK2 is facilitated by direct docking of the receptor P1 domain to the kinase. Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. Only protein-protein interactions imex curation ma-2010-8 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. DIP original experiment: DIP-217208X Structure (London, England : 1993) 2010 IMEx Phosphorylation of DCC by ERK2 is facilitated by direct docking of the receptor P1 domain to the kinase. Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. Only protein-protein interactions imex curation ma-2010-9 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. DIP original experiment: DIP-217210X Structure (London, England : 1993) 2010 IMEx Phosphorylation of DCC by ERK2 is facilitated by direct docking of the receptor P1 domain to the kinase. Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. Only protein-protein interactions imex curation ma-2010-10 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. DIP original experiment: DIP-217213X Structure (London, England : 1993) 2010 IMEx Phosphorylation of DCC by ERK2 is facilitated by direct docking of the receptor P1 domain to the kinase. Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. Only protein-protein interactions imex curation ma-2010-11 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. DIP original experiment: DIP-217215X Structure (London, England : 1993) 2010 IMEx Phosphorylation of DCC by ERK2 is facilitated by direct docking of the receptor P1 domain to the kinase. Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. Only protein-protein interactions imex curation ma-2010-12 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. DIP original experiment: DIP-217211X Structure (London, England : 1993) 2010 IMEx Phosphorylation of DCC by ERK2 is facilitated by direct docking of the receptor P1 domain to the kinase. Ma W., Shang Y., Wei Z., Wen W., Wang W., Zhang M. Only protein-protein interactions imex curation mk01_rat Mitogen-activated protein kinase 1 Mapk1 Erk2 Mapk Prkm1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 protein protein rat Rattus norvegicus (Rat) Rat MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS dcc_rat Netrin receptor DCC Dcc Tumor suppressor protein DCC protein protein rat Rattus norvegicus (Rat) Rat MENSLGCVWVPKLAFVLFGASLLSAHLQVTGFQIKPFTSLHFVSEPSDAVTMRGGNVLLNCSAESDRGVPVIKWKKDGLILALGMDDRKQQLPNGSLLIQNILHSRHHKPDEGLYQCEASLGDSGSIISRTAKVMVAGPLRFLSQTESITAFMGDTVLLKCEVIGDPMPTIHWQKNQQDLNPIPGDSRVVVLPSGALQISRLQPGDSGVYRCSARNPASTRTGNEAEVRILSDPGLHRQLYFLQRPSNVIAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNVTDDDSGTYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECAVSGKPVPTVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQSSAQLIVPKPAIPSSSILPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTTQPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLHAVSASPTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYTLRFLAYNRYGPGVSTDDITVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDLDESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRYYSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSGPDVSTPMLPPVGVQAVALTHEAVRVSWADNSVPKNQKTSDVRLYTVRWRTSFSASAKYKSEDTTSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKPRAVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLSLDTMYYFRIQARNAKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPIGQMHPPHGSVTPQKNSNLLVITVVTVGVLTVLVVVIVAVICTRRSSAQQRKKRATHSASKRKGSQKDLRPPDLWIHHEEMEMKNIEKPAGTDPAGRGSPIQSCQDLTPVSHSQSESQMGSKSASHSGQDTEEAGSSMSTLERSLAARRATRTKLMIPMEAQSNNPAVVSAIPVPTLESAQYPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRTVSEGPTAQQQPMLPPAQPEHPSSEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDPASVYEQDDLSEQMASLEGLMKQLNAITGSAF dcc-mapk1-1 3217537 N/A 3217547 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3217548 unspecified role unspecified role bait bait Region 1120-1326 Region 1120-1326 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false mapk1-dcc-1 3217538 N/A 3217547 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3217548 unspecified role unspecified role prey prey Region 1120-1212 Region 1120-1212 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dcc-mapk1-2 3217539 N/A 3217547 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli N/A 3217548 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1120-1445 Region 1120-1445 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q63155:p.[Ser1178Ala;Thr1187Ala;Ser1267Ala] S1178A/T1187A/S1267A mutation disrupting mutation disrupting interaction mutation disrupting mobility shift mobility shift certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false dcc-mapk1-3 3217540 N/A 3217547 unspecified role unspecified role unspecified role unspecified role P63086:p.[Gln117Ala;His123Ala] Q117A/H123A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217548 unspecified role unspecified role unspecified role unspecified role Region 1140-1166 Region 1140-1166 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false FITC-label FITC-label fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro direct interaction direct interaction false false false dcc-mapk1-4 3217541 N/A 3217547 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli N/A 3217548 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1120-1212 Region 1120-1212 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q63155:p.[Ser1178Ala;Thr1187Ala] S1178A/T1187A mutation disrupting mutation disrupting interaction mutation disrupting mobility shift mobility shift certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false dcc-mapk1-5 3217542 N/A 3217547 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3217548 unspecified role unspecified role bait bait Region 1120-1212 Region 1120-1212 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false dcc-mapk1-6 3217543 N/A 3217547 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3217548 unspecified role unspecified role unspecified role unspecified role Region 1120-1212 Region 1120-1212 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dcc-mapk1-7 3217544 N/A 3217547 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3217548 unspecified role unspecified role unspecified role unspecified role Region 1140-1166 Region 1140-1166 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false dcc-mapk1-8 3217545 N/A 3217547 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli N/A 3217548 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1120-1326 Region 1120-1326 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q63155:p.[Ser1178Ala;Thr1187Ala;Ser1267Ala] S1178A/T1187A/S1267A mutation disrupting mutation disrupting interaction mutation disrupting mobility shift mobility shift certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false pS1178 pS1178 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false dcc-mapk1-9 3217546 N/A 3217547 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3217548 unspecified role unspecified role unspecified role unspecified role Region 1120-1212 Region 1120-1212 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false