DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hammel-2010-1 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. DIP original experiment: DIP-217201X Structure (London, England : 1993) 2010 IMEx XLF regulates filament architecture of the XRCC4·ligase IV complex. Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. Only protein-protein interactions imex curation hammel-2010-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. DIP original experiment: DIP-217193X Structure (London, England : 1993) 2010 IMEx XLF regulates filament architecture of the XRCC4·ligase IV complex. Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. Only protein-protein interactions imex curation hammel-2010-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. DIP original experiment: DIP-217199X Structure (London, England : 1993) 2010 IMEx XLF regulates filament architecture of the XRCC4·ligase IV complex. Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. Only protein-protein interactions imex curation hammel-2010-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. DIP original experiment: DIP-217203X Structure (London, England : 1993) 2010 IMEx XLF regulates filament architecture of the XRCC4·ligase IV complex. Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. Only protein-protein interactions imex curation hammel-2010-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. DIP original experiment: DIP-217197X Structure (London, England : 1993) 2010 IMEx XLF regulates filament architecture of the XRCC4·ligase IV complex. Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. Only protein-protein interactions imex curation hammel-2010-6 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. DIP original experiment: DIP-217194X Structure (London, England : 1993) 2010 IMEx XLF regulates filament architecture of the XRCC4·ligase IV complex. Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. Only protein-protein interactions imex curation hammel-2010-7 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. DIP original experiment: DIP-217202X Structure (London, England : 1993) 2010 IMEx XLF regulates filament architecture of the XRCC4·ligase IV complex. Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. Only protein-protein interactions imex curation hammel-2010-8 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. DIP original experiment: DIP-217200X Structure (London, England : 1993) 2010 IMEx XLF regulates filament architecture of the XRCC4·ligase IV complex. Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. Only protein-protein interactions imex curation hammel-2010-9 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. DIP original experiment: DIP-217195X Structure (London, England : 1993) 2010 IMEx XLF regulates filament architecture of the XRCC4·ligase IV complex. Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. Only protein-protein interactions imex curation hammel-2010-10 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. DIP original experiment: DIP-217204X Structure (London, England : 1993) 2010 IMEx XLF regulates filament architecture of the XRCC4·ligase IV complex. Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. Only protein-protein interactions imex curation hammel-2010-11 in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. DIP original experiment: DIP-217198X Structure (London, England : 1993) 2010 IMEx XLF regulates filament architecture of the XRCC4·ligase IV complex. Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. Only protein-protein interactions imex curation hammel-2010-12 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. DIP original experiment: DIP-217196X Structure (London, England : 1993) 2010 IMEx XLF regulates filament architecture of the XRCC4·ligase IV complex. Hammel M., Yu Y., Fang S., Lees-Miller SP., Tainer JA. Only protein-protein interactions imex curation q9h9q4-1 Non-homologous end-joining factor 1 NHEJ1 XLF Protein cernunnos XRCC4-like factor protein protein human Homo sapiens Human MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS q13426-2 DNA repair protein XRCC4 XRCC4 X-ray repair cross-complementing protein 4 protein protein human Homo sapiens Human MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNLGTEPKMAPQENQLQEKEKPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI dnli4_human DNA ligase 4 DNA ligase IV Polydeoxyribonucleotide synthase [ATP] 4 LIG4 protein protein human Homo sapiens Human MAASQTSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHKDVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTPTGTHGDAGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSGLMDELDILIVGGYWGKGSRGGMMSHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRGKASGKLASKHLYIGGDDEPQEKKRKAAPKMKKVIGIIEHLKAPNLTNVNKISNIFEDVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDKCELQEENQYLI nhej1-xrcc4-3 3217470 N/A 3217482 unspecified role unspecified role unspecified role unspecified role Region 1-248 Region 1-248 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217483 unspecified role unspecified role unspecified role unspecified role Region 1-140 Region 1-140 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false xrcc4-1 3217471 N/A 3217483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false nhej1-xrcc4-4 3217472 N/A 3217482 unspecified role unspecified role unspecified role unspecified role Region 1-248 Region 1-248 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217483 unspecified role unspecified role unspecified role unspecified role Region 1-140 Region 1-140 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lig4-nhej1-1 3217473 N/A 3217482 unspecified role unspecified role unspecified role unspecified role Region 1-248 Region 1-248 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217484 unspecified role unspecified role unspecified role unspecified role BRCT domain Region 618-911 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false lig4-xrcc4-13 3217474 N/A 3217484 unspecified role unspecified role unspecified role unspecified role BRCT domain Region 618-911 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false xrcc4-3 3217475 N/A 3217483 unspecified role unspecified role unspecified role unspecified role Region 1-140 Region 1-140 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false lig4-nhej1-2 3217476 N/A 3217482 unspecified role unspecified role unspecified role unspecified role Region 1-248 Region 1-248 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217484 unspecified role unspecified role unspecified role unspecified role BRCT domain Region 618-911 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false nhej1-xrcc4-5 3217477 N/A 3217482 unspecified role unspecified role unspecified role unspecified role Region 1-248 Region 1-248 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217483 unspecified role unspecified role unspecified role unspecified role Region 1-140 Region 1-140 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false xrcc4-4 3217478 N/A 3217483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false lig4-nhej1-3 3217479 N/A 3217482 unspecified role unspecified role unspecified role unspecified role Region 1-248 Region 1-248 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217484 unspecified role unspecified role unspecified role unspecified role BRCT domain Region 618-911 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false lig4-xrcc4-14 3217480 N/A 3217484 unspecified role unspecified role unspecified role unspecified role BRCT domain Region 618-911 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false lig4-xrcc4-15 3217481 N/A 3217484 unspecified role unspecified role unspecified role unspecified role BRCT domain Region 618-911 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217483 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false