UniProt UniProt http://www.uniprot.org fontanesi-2011-1 yeast Saccharomyces cerevisiae Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Fontanesi F., Clemente P., Barrientos A. Additional details of constructs taken from PMID:15306853 as referenced in the text. abarrientos@med.miami.edu The Journal of biological chemistry 2011 imex curation Only protein-protein interactions imex curation cox14_yeast Cytochrome c oxidase assembly protein COX14 COX14 YM4987.06C YML129C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKYAWYTRVTDTLHRLTVLTLVGGTLYMSGGLAYTLYMNGKKYEQQVTQQKALEEDNQQLQSPTAPPTE coa3_yeast Cytochrome c oxidase assembly factor 3, mitochondrial COA3 COX25 RRG10 Required for respiratory growth protein 10 YJL062W-A Cytochrome c oxidase protein 25 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLNPSKYQDTRTWKMTPAMIRARKPFFKGNMLGLTLLLGVTGSVYYYTYHFLHKDNDFADVPIPPIDPQELEALKKEYEAKKKA mss51_yeast Protein MSS51, mitochondrial MSS51 YLR203C L8167.17 Mitochondrial splicing suppressor protein 51 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTVLYAPSGATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKRQ shy1_yeast Cytochrome oxidase assembly protein SHY1 SHY1 YGR112W G6150 SURF1-like protein SURF1 homolog of Yeast protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLLGARSTYRWFSIAASIPTKNAIGKSTYLLASRNQQYRGIITSTVDWKPIKTGKSPNDDSRRERSFGKKIVLGLMFAMPIISFYLGTWQVRRLKWKTKLIAACETKLTYEPIPLPKSFTPDMCEDWEYRKVILTGHFLHNEEMFVGPRKKNGEKGYFLFTPFIRDDTGEKVLIERGWISEEKVAPDSRNLHHLSLPQEEHLKVVCLVRPPKKRGSLQWAKKDPNSRLWQVPDIYDMARSSGCTPIQFQALYDMKDHPIIEEHTRNEASQNNSTSSLWKFWKREPTTAVNGTQAVDNNTSKPRSRQEMPTDQTIEFDERQFIKAGVPIGRKPTIDLKNNHLQYLVTWYGLSFLSTIFLIVALRKAKRGGVVSQDQLMKEKLKHSRKYM cox5b_yeast Cytochrome c oxidase subunit 5B, mitochondrial COX5B Cytochrome c oxidase polypeptide Vb YIL111W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRTSLTKGARLTGTRFVQTKALSKATLTDLPERWENMPNLEQKEIADNLTERQKLPWKTLNNEEIKAAWYISYGEWGPRRPVHGKGDVAFITKGVFLGLGISFGLFGLVRLLANPETPKTMNREWQLKSDEYLKSKNANPWGGYSQVQSK cox5a_yeast Cytochrome c oxidase subunit 5A, mitochondrial COX5A YNL052W N2474 YNL2474W Cytochrome c oxidase polypeptide Va protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK mss51-coa3-2 3323362 N/A 3323363 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3323364 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3323365 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Interaction observed in cox11-/- cells Fig. 6B cox14-coa3-1 3323362 N/A 3323363 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3323364 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3323365 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell association association false false false Interaction observed in cox11-/- cells Fig. 6B mss51-coa3-1 3323362 N/A 3323364 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3323365 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 6A Interaction observed in cox11-/- cells coa3-cox14-1 3323362 N/A 3323366 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3323363 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3323364 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed living cell living cell c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3323365 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3323367 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3323368 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell association association false false false Fig. 6B, 6D COX5 (A/B not specified) was efficiently pulled down in SHY1-/- cells, but not in COX14-/- cells. The identification of COX5A/B in the complex was made by molecular weight difference using a common antibody