DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ta-2010-1 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. DIP original experiment: DIP-220617X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. Only protein-protein interactions imex curation ta-2010-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. DIP original experiment: DIP-220615X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. Only protein-protein interactions imex curation ta-2010-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. DIP original experiment: DIP-220619X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. Only protein-protein interactions imex curation ta-2010-4 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. DIP original experiment: DIP-220616X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. Only protein-protein interactions imex curation ta-2010-5 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. DIP original experiment: DIP-220618X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure-based development of a receptor activator of nuclear factor-kappaB ligand (RANKL) inhibitor peptide and molecular basis for osteopetrosis. Ta HM., Nguyen GT., Jin HM., Choi J., Park H., Kim N., Hwang HY., Kim KK. Only protein-protein interactions imex curation tnr11_mouse Tumor necrosis factor receptor superfamily member 11A Receptor activator of NF-KB Osteoclast differentiation factor receptor Tnfrsf11a Rank protein protein mouse Mus musculus Mouse MAPRARRRRQLPAPLLALCVLLVPLQVTLQVTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLPSLIVLLLFISVVVVAAIIFGVYYRKGGKALTANLWNWVNDACSSLSGNKESSGDRCAGSHSATSSQQEVCEGILLMTREEKMVPEDGAGVCGPVCAAGGPWAEVRDSRTFTLVSEVETQGDLSRKIPTEDEYTDRPSQPSTGSLLLIQQGSKSIPPFQEPLEVGENDSLSQCFTGTESTVDSEGCDFTEPPSRTDSMPVSPEKHLTKEIEGDSCLPWVVSSNSTDGYTGSGNTPGEDHEPFPGSLKCGPLPQCAYSMGFPSEAAASMAEAGVRPQDRADERGASGSGSSPSDQPPASGNVTGNSNSTFISSGQVMNFKGDIIVVYVSQTSQEGPGSAEPESEPVGRPVQEETLAHRDSFAGTAPRFPDVCATGAGLQEQGAPRQKDGTSRPVQEQGGAQTSLHTQGSGQCAE o35235-1 Tumor necrosis factor ligand superfamily member 11 Tnfsf11 Opgl Rankl Trance Osteoclast differentiation factor Osteoprotegerin ligand Receptor activator of nuclear factor kappa-B ligand TNF-related activation-induced cytokine protein protein mouse Mus musculus Mouse MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQVVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID op34 RANKL inhibitor peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) YCEIEFCYLIR l33 RANKL inhibitor peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) YCWNSDCECCYRR tnfrsf11a-tnfsf11-11 3217379 N/A 3217384 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 32-201 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false O35305:p.Glu126Ala E126A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O35305:p.Lys97Ala K97A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O35305:p.Asp85Ala D85A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O35305:p.Cys127Ala C127A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O35305:p.Gly54Arg G54R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O35305:p.Lys171Gly K171G mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217385 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 157-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tnfrsf11a-tnfsf11-12 3217380 N/A 3217384 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 32-201 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217385 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 157-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false op34-tnfsf11-1 3217381 N/A 3217386 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3217385 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 157-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tnfrsf11a-tnfsf11-13 3217382 N/A 3217384 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 32-201 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217385 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 157-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false l33-tnfsf11-1 3217383 N/A 3217387 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3217385 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 157-316 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false