DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kim-2010-35 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. DIP original experiment: DIP-220580X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Phosphorylation of the spindle checkpoint protein Mad2 regulates its conformational transition. Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. Only protein-protein interactions imex curation kim-2010-36 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. DIP original experiment: DIP-220584X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Phosphorylation of the spindle checkpoint protein Mad2 regulates its conformational transition. Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. Only protein-protein interactions imex curation kim-2010-37 in vitro In vitro pull down pull down autoradiography autoradiography Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. DIP original experiment: DIP-220583X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Phosphorylation of the spindle checkpoint protein Mad2 regulates its conformational transition. Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. Only protein-protein interactions imex curation kim-2010-38 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. DIP original experiment: DIP-220581X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Phosphorylation of the spindle checkpoint protein Mad2 regulates its conformational transition. Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. Only protein-protein interactions imex curation kim-2010-39 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. DIP original experiment: DIP-220586X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Phosphorylation of the spindle checkpoint protein Mad2 regulates its conformational transition. Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. Only protein-protein interactions imex curation kim-2010-40 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. DIP original experiment: DIP-220585X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Phosphorylation of the spindle checkpoint protein Mad2 regulates its conformational transition. Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. Only protein-protein interactions imex curation kim-2010-41 in vitro In vitro pull down pull down autoradiography autoradiography Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. DIP original experiment: DIP-220582X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Phosphorylation of the spindle checkpoint protein Mad2 regulates its conformational transition. Kim S., Sun H., Ball HL., Wassmann K., Luo X., Yu H. Only protein-protein interactions imex curation cdc20_human Cell division cycle protein 20 homolog CDC20 p55CDC protein protein human Homo sapiens Human MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR md2l1_human Mitotic spindle assembly checkpoint protein MAD2A MAD2L1 MAD2 Mitotic arrest deficient 2-like protein 1 protein protein human Homo sapiens Human MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND md1l1_human Mitotic spindle assembly checkpoint protein MAD1 Mitotic arrest deficient 1-like protein 1 Mitotic checkpoint MAD1 protein homolog Tax-binding protein 181 MAD1L1 MAD1 TXBP181 protein protein human Homo sapiens Human MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQLEERAEQIRSKSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDAASKRLREKEDSLAQAGETINALKGRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKKCQEANQKIQELQASQEARADHEQQIKDLEQKLSLQEQDAAIVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQEELEGLQRKLGRQEKMQETLVGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKDKNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDSELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKMLKSQSSSAEQSFLFSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA cdc20-mad2l1-13 3217104 N/A 3217111 unspecified role unspecified role unspecified role unspecified role Region 124-137 Region 124-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217112 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mad2l1-cdc20-3 3217105 N/A 3217112 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3217111 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3217113 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3217112 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human association association false false false mad2l1-cdc20-4 3217106 N/A 3217111 unspecified role unspecified role prey prey Region 124-137 Region 124-137 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3217112 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 196-205 Region 196-205 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q13257:p.Ser195Asp S195D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mad1l1-mad2l1-9 3217107 N/A 3217113 unspecified role unspecified role unspecified role unspecified role Region 495-718 Region 495-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3217112 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mad2l1-cdc20-5 3217108 N/A 3217111 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3217112 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q13257:p.Ser195Asp S195D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false mad2l1-mad1l1-3 3217109 N/A 3217112 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3217113 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3217112 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q13257:p.Ser195Asp S195D mutation mutation certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false mad2l1-mad1l1-4 3217110 N/A 3217113 unspecified role unspecified role prey prey Region 495-718 Region 495-718 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3217112 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 196-205 Region 196-205 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false