DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ gruber-2010-1 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gruber H., Heijde M., Heller W., Albert A., Seidlitz HK., Ulm R. DIP original experiment: DIP-260202X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Negative feedback regulation of UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis. Gruber H., Heijde M., Heller W., Albert A., Seidlitz HK., Ulm R. Only protein-protein interactions imex curation gruber-2010-2 sinal Sinapis alba (White mustard) Brassica hirta White mustard bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Gruber H., Heijde M., Heller W., Albert A., Seidlitz HK., Ulm R. DIP original experiment: DIP-260200X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Negative feedback regulation of UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis. Gruber H., Heijde M., Heller W., Albert A., Seidlitz HK., Ulm R. Only protein-protein interactions imex curation gruber-2010-3 sinal Sinapis alba (White mustard) Brassica hirta White mustard bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Gruber H., Heijde M., Heller W., Albert A., Seidlitz HK., Ulm R. DIP original experiment: DIP-260201X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Negative feedback regulation of UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis. Gruber H., Heijde M., Heller W., Albert A., Seidlitz HK., Ulm R. Only protein-protein interactions imex curation gruber-2010-4 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gruber H., Heijde M., Heller W., Albert A., Seidlitz HK., Ulm R. DIP original experiment: DIP-260203X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Negative feedback regulation of UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis. Gruber H., Heijde M., Heller W., Albert A., Seidlitz HK., Ulm R. Only protein-protein interactions imex curation gruber-2010-5 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Gruber H., Heijde M., Heller W., Albert A., Seidlitz HK., Ulm R. DIP original experiment: DIP-260204X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Negative feedback regulation of UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis. Gruber H., Heijde M., Heller W., Albert A., Seidlitz HK., Ulm R. Only protein-protein interactions imex curation rup2_arath WD repeat-containing protein RUP2 RUP2 EFO2 Protein EARLY FLOWERING BY OVEREXPRESSION 2 Protein REPRESSOR OF UV-B PHOTOMORPHOGENESIS 2 MRO11.23 At5g23730 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNTLHPHKQQQEQAQQQEEARYEWDLSLSTVVSSSSSSASDVIGAIEFDPTDNIVATAGISRKIRFYGLPSLLRNNAVSGTGVSFVDQATACEYYICTPAKLSSLRWRPGSGGRVIGSGDYDGVVMEYDLEKRTPVFERDEHGGRRVWSVDYTRHGGASTVGASGSDDGTMQVWDPRCPPEESVGVVRPAGICRSAVCCVEFDPSGGPAVAVGCADRKGYVYDIRKLVDPALTLQGHTKTVSYVRFLDGGTVVTAGTDGCLKLWSVEDGRVIRTYEGHVNNRNFVGLSVWRNGALFGCGSENNRVFVYDRRWGKPVWVDGFEPVGMNSGSDKRFVSSVCWRQSGVDQCTLVAGGSDGVLQVYVGKRKP uvr8_arath Ultraviolet-B receptor UVR8 UVR8 Protein UV-B RESISTANCE 8 RCC1 domain-containing protein UVR8 MGI19.7 At5g63860 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEDMAADEVTAPPRKVLIISAGASHSVALLSGDIVCSWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDLYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKMSMVACGWRHTISVSYSGALYTYGWSKYGQLGHGDLEDHLIPHKLEALSNSFISQISGGWRHTMALTSDGKLYGWGWNKFGQVGVGNNLDQCSPVQVRFPDDQKVVQVSCGWRHTLAVTERNNVFAWGRGTNGQLGIGESVDRNFPKIIEALSVDGASGQHIESSNIDPSSGKSWVSPAERYAVVPDETGLTDGSSKGNGGDISVPQTDVKRVRI rup1_arath WD repeat-containing protein RUP1 RUP1 EFO1 Protein EARLY FLOWERING BY OVEREXPRESSION 1 Protein REPRESSOR OF UV-B PHOTOMORPHOGENESIS 1 F17P19.15 At5g52250 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEALFCSEIPNNNIRSSINDLSSSSSYTWPMIMTSSSSSSSSPTIMNIENIPRCDWDLSLSAVVSSASTGSDAIGAIEFDPTGEIIATGGIARKIRSYRLSSLLESRDDHVTASESYICTPAKLSSLKWRPDFSGRVIGSGDYDGVVTEYDVEKQVPVSERDEHGGRRIWSVDYTLYNGSLIGASGSDDGTVQMWDPRNGGTLEETVRPGGGAAICSVEFDPFGGSSIAVGCADRNAYVYDIRRLVDPLIVLDGHTKTVTYARFMDSHTIVTGSTDGSLKQWDIDNGRRVVRTYRGHVNSRNFVGLSVWRHGGLVVSGSENNQVFVYDKRWEEPVWVCGLGHTNRFGSDRRFVSSVCLRQVDEDWCTLVAGGSDGALEIFSGKQS cop1_arath E3 ubiquitin-protein ligase COP1 COP1 Constitutive photomorphogenesis protein 1 RING-type E3 ubiquitin transferase COP1 T21L14.11 At2g32950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEISTDPVVPAVKPDPRTSSVGEGANRHENDDGGSGGSEIGAPDLDKDLLCPICMQIIKDAFLTACGHSFCYMCIITHLRNKSDCPCCSQHLTNNQLYPNFLLDKLLKKTSARHVSKTASPLDQFREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEVQTDLQYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDPSTRNAWPHEKNQIGFNSNSLSIRGGNFVGNYQNKKVEGKAQGSSHGLPKKDALSGSDSQSLNQSTVSMARKKRIHAQFNDLQECYLQKRRQLADQPNSKQENDKSVVRREGYSNGLADFQSVLTTFTRYSRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGSADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLAA rup2-uvr8-1 3217012 N/A 3217017 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3217018 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false rup1-uvr8-1 3217013 N/A 3217018 unspecified role unspecified role unspecified role unspecified role N-terminal domain of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false sinal Sinapis alba (White mustard) Brassica hirta White mustard N/A 3217019 unspecified role unspecified role unspecified role unspecified role C-terminal domain of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false sinal Sinapis alba (White mustard) Brassica hirta White mustard direct interaction direct interaction false false false rup2-uvr8-2 3217014 N/A 3217017 unspecified role unspecified role unspecified role unspecified role C-terminal domain of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false sinal Sinapis alba (White mustard) Brassica hirta White mustard N/A 3217018 unspecified role unspecified role unspecified role unspecified role N-terminal domain of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false sinal Sinapis alba (White mustard) Brassica hirta White mustard direct interaction direct interaction false false false cop1-uvr8-3 3217015 N/A 3217020 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3217018 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false uvr8-rup2-1 3217016 N/A 3217017 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3217018 unspecified role unspecified role bait bait arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false