DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ alte-2010-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alte F., Stengel A., Benz JP., Petersen E., Soll J., Groll M., Bölter B. DIP original experiment: DIP-220530X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Ferredoxin:NADPH oxidoreductase is recruited to thylakoids by binding to a polyproline type II helix in a pH-dependent manner. Alte F., Stengel A., Benz JP., Petersen E., Soll J., Groll M., Bölter B. Only protein-protein interactions imex curation alte-2010-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Alte F., Stengel A., Benz JP., Petersen E., Soll J., Groll M., Bölter B. DIP original experiment: DIP-220528X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Ferredoxin:NADPH oxidoreductase is recruited to thylakoids by binding to a polyproline type II helix in a pH-dependent manner. Alte F., Stengel A., Benz JP., Petersen E., Soll J., Groll M., Bölter B. Only protein-protein interactions imex curation alte-2010-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Alte F., Stengel A., Benz JP., Petersen E., Soll J., Groll M., Bölter B. DIP original experiment: DIP-220532X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Ferredoxin:NADPH oxidoreductase is recruited to thylakoids by binding to a polyproline type II helix in a pH-dependent manner. Alte F., Stengel A., Benz JP., Petersen E., Soll J., Groll M., Bölter B. Only protein-protein interactions imex curation alte-2010-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Alte F., Stengel A., Benz JP., Petersen E., Soll J., Groll M., Bölter B. DIP original experiment: DIP-220531X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Ferredoxin:NADPH oxidoreductase is recruited to thylakoids by binding to a polyproline type II helix in a pH-dependent manner. Alte F., Stengel A., Benz JP., Petersen E., Soll J., Groll M., Bölter B. Only protein-protein interactions imex curation alte-2010-5 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alte F., Stengel A., Benz JP., Petersen E., Soll J., Groll M., Bölter B. DIP original experiment: DIP-220529X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Ferredoxin:NADPH oxidoreductase is recruited to thylakoids by binding to a polyproline type II helix in a pH-dependent manner. Alte F., Stengel A., Benz JP., Petersen E., Soll J., Groll M., Bölter B. Only protein-protein interactions imex curation fenr1_pea Ferredoxin--NADP reductase, leaf isozyme, chloroplastic PETH protein protein pea Pisum sativum (Garden pea) Garden pea MAAAVTAAVSLPYSNSTSLPIRTSIVAPERLVFKKVSLNNVSISGRVGTIRAQVTTEAPAKVVKHSKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVY tic62_pea Protein TIC 62, chloroplastic Translocon at the inner envelope membrane of chloroplasts 62 TIC62 protein protein pea Pisum sativum (Garden pea) Garden pea MPMEVFSLTSTAIPSTLTRRDTAADKPSPHLNLSKYSHFMRYPLTTTLTNNRIRSSSSSSSSIRAQASGSTKSSTAEGIPEKTDSKDDNLVFVAGATGKVGSRTVRELIKLGFKVRAGVRNAQKAGALVQSVKQLKLDGASGGGEAVEKLEIVECDLEKADQIGSALGNASTVICAIGASEKEIFDITGPCRIDYRATKNLVDAATVAKVNHFILVTSLGTNKFGLPAAILNLFWGVLIWKRKAEEALLASGIPYTIVRPGGMERPTDAYKETHNVTLSTEDTLFGGQVSNLQVAELMAIMAKNPDLSYCKIVEVIAETTAPLTPAEKLLTRIPSQRPYIPSPKKVQKADTATVSNTGPSANVVAEVPSIAPQKETASKPVAKTEQPLSPYTAYDDLKPPSSPSPTKPSEKKQINISDAVPTPISSDTPSSIQEIDGISQTTSSSKGKESLSPYAAYPDLKPPSSPSPSVPTTSLSKRDTVVVSSNGPAQLSVEDTPKNEEQHLHEPKSRPLSPYAMYEDLKPPASPSPSFRKS tic62-peth-1 3216709 N/A 3216714 unspecified role unspecified role prey prey Region 66-360 Region 66-360 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3216715 unspecified role unspecified role bait bait Region 346-534 Region 346-534 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false peth-tic62-1 3216710 N/A 3216714 unspecified role unspecified role unspecified role unspecified role Region 66-360 Region 66-360 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3216715 unspecified role unspecified role unspecified role unspecified role Region 383-408 Region 383-408 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false peth-tic62-2 3216711 N/A 3216714 unspecified role unspecified role unspecified role unspecified role Region 66-360 Region 66-360 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3216715 unspecified role unspecified role unspecified role unspecified role Region 383-408 Region 383-408 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false peth-tic62-3 3216712 N/A 3216714 unspecified role unspecified role unspecified role unspecified role Region 66-360 Region 66-360 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3216715 unspecified role unspecified role unspecified role unspecified role Region 346-534 Region 346-534 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false tic62-peth-2 3216713 N/A 3216714 unspecified role unspecified role prey prey Region 66-360 Region 66-360 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3216715 unspecified role unspecified role bait bait Region 383-408 Region 383-408 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false