DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chen-2010-30 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254116X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions imex curation chen-2010-31 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254121X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions imex curation chen-2010-32 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254122X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions imex curation chen-2010-33 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254119X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions imex curation chen-2010-34 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254117X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions imex curation chen-2010-35 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254120X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions imex curation chen-2010-36 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254123X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions imex curation chen-2010-37 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. DIP original experiment: DIP-254118X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Autophagy protein microtubule-associated protein 1 light chain-3B (LC3B) activates extrinsic apoptosis during cigarette smoke-induced emphysema. Chen ZH., Lam HC., Jin Y., Kim HP., Cao J., Lee SJ., Ifedigbo E., Parameswaran H., Ryter SW., Choi AM. Only protein-protein interactions imex curation p25445-1 Tumor necrosis factor receptor superfamily member 6 FAS APT1 FAS1 TNFRSF6 Apo-1 antigen Apoptosis-mediating surface antigen FAS FASLG receptor protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG map1lc3b-fas-1 3216132 N/A 3216140 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3216141 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false cav1-fas-1 3216133 N/A 3216140 unspecified role unspecified role prey prey P25445-1:p.Cys199Ser C199S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3216142 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false cav1-map1lc3b-1 3216134 N/A 3216142 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3216141 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false Deletion of region 82-101 decreased the interaction rate/strength. fas-casp8-2 3216135 N/A 3216143 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3216140 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false map1lc3b-cav1-1 3216136 N/A 3216142 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3216141 unspecified role unspecified role bait bait Q9GZQ8:p.Tyr113Ala Y113A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false cav1-fas-3 3216137 N/A 3216142 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3216140 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false bax-bid-1 3216138 N/A 3216144 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3216145 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false fas-cav1-1 3216139 N/A 3216142 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3216140 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false