DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ daugherty-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Daugherty MD., Liu B., Frankel AD. DIP original experiment: DIP-217689X Nature structural & molecular biology 2010 IMEx Structural basis for cooperative RNA binding and export complex assembly by HIV Rev. Daugherty MD., Liu B., Frankel AD. Only protein-protein interactions imex curation daugherty-2010-2 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Daugherty MD., Liu B., Frankel AD. DIP original experiment: DIP-217690X Nature structural & molecular biology 2010 IMEx Structural basis for cooperative RNA binding and export complex assembly by HIV Rev. Daugherty MD., Liu B., Frankel AD. Only protein-protein interactions imex curation daugherty-2010-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Daugherty MD., Liu B., Frankel AD. DIP original experiment: DIP-217691X Nature structural & molecular biology 2010 IMEx Structural basis for cooperative RNA binding and export complex assembly by HIV Rev. Daugherty MD., Liu B., Frankel AD. Only protein-protein interactions imex curation rev_hv1h2 Protein Rev rev ART/TRS Anti-repression transactivator Regulator of expression of viral proteins protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE rev-5 3216073 N/A 3216076 unspecified role unspecified role unspecified role unspecified role Region 1-70 Region 1-70 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rev-6 3216074 N/A 3216076 unspecified role unspecified role unspecified role unspecified role Region 1-70 Region 1-70 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rev-7 3216075 N/A 3216076 unspecified role unspecified role unspecified role unspecified role Region 1-70 Region 1-70 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false