DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ colbert-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. DIP original experiment: DIP-250123X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of Spot 14, a modulator of fatty acid synthesis. Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. Only protein-protein interactions imex curation colbert-2010-2 crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. DIP original experiment: DIP-250129X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of Spot 14, a modulator of fatty acid synthesis. Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. Only protein-protein interactions imex curation colbert-2010-3 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. DIP original experiment: DIP-250124X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of Spot 14, a modulator of fatty acid synthesis. Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. Only protein-protein interactions imex curation colbert-2010-4 crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. DIP original experiment: DIP-250127X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of Spot 14, a modulator of fatty acid synthesis. Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. Only protein-protein interactions imex curation colbert-2010-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. DIP original experiment: DIP-250125X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of Spot 14, a modulator of fatty acid synthesis. Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. Only protein-protein interactions imex curation colbert-2010-6 crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. DIP original experiment: DIP-250126X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of Spot 14, a modulator of fatty acid synthesis. Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. Only protein-protein interactions imex curation colbert-2010-7 crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. DIP original experiment: DIP-250128X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of Spot 14, a modulator of fatty acid synthesis. Colbert CL., Kim CW., Moon YA., Henry L., Palnitkar M., McKean WB., Fitzgerald K., Deisenhofer J., Horton JD., Kwon HJ. Only protein-protein interactions imex curation thrsp_mouse Thyroid hormone-inducible hepatic protein Thrsp S14 Spot 14 protein protein protein mouse Mus musculus Mouse MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPSLLRDVQLSGPGGSVQDGAPDLYTYFTMLKSICVEVDHGLLPREEWQAKVAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLHFCSLHHILTHLTRKAQEVTRKYQEMTGQVL g3h9d1_crigr Acetyl-CoA carboxylase 1 I79_006999 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MGVQVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGILPKIQSTALRGEKLHRVFHYVLDNLVNVMSGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPLNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRMSFASNLNHYGMTHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEIMGCFCDSPPQSPTFPESGHTSLYDEDKAPRDEPIHILNVAIKTDGDIEDDRLAAMFREFTQQNKATLVEHGIRRLTFLVAQKDFRKQVNCEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTTTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQIGMVAWKMSLKSPEYPDGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAWVDPEDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSGMIAGESSLAYDEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDPIDRIIEFVPTKAPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDPTINPRHMEMYADRESRGSVLEPEGTVEIKFRKKDLVKTMRRVDPVYIHLAERLGTPELSPIERKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRSFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLTEEDGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTMDSPST m1ip1_mouse Mid1-interacting protein 1 Mid1ip1 Mig12 Gastrulation-specific G12-like protein Mid1-interacting G12-like protein Protein STRAIT11499 homolog Spot 14-related protein protein protein mouse Mus musculus Mouse MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLSEPEIDEVSVEVGGSGGCLEERTTPAPSPGSANESFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPSSPPAGSEESTWKPKDILVGLSHLESADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFSNWGH thrsp-1 3216014 N/A 3216021 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false thrsp-g3h9d1_crigr-1 3216015 N/A 3216022 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3216021 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association false false false thrsp-2 3216016 N/A 3216021 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mid1ip1-g3h9d1_crigr-1 3216017 N/A 3216022 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3216023 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3216021 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster association association false false false thrsp-3 3216018 N/A 3216021 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false thrsp-g3h9d1_crigr-2 3216019 N/A 3216022 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3216023 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3216021 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster association association false false false mid1ip1-g3h9d1_crigr-2 3216020 N/A 3216022 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3216023 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association false false false