DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ghasriani-2010-1 ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. DIP original experiment: DIP-220487X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. Only protein-protein interactions imex curation ghasriani-2010-2 in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. DIP original experiment: DIP-220488X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. Only protein-protein interactions imex curation ghasriani-2010-3 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. DIP original experiment: DIP-220490X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. Only protein-protein interactions imex curation ghasriani-2010-4 in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. DIP original experiment: DIP-220489X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Appropriation of the MinD protein-interaction motif by the dimeric interface of the bacterial cell division regulator MinE. Ghasriani H., Ducat T., Hart CT., Hafizi F., Chang N., Al-Baldawi A., Ayed SH., Lundström P., Dillon JA., Goto NK. Only protein-protein interactions imex curation mine_neigo Cell division topological specificity factor minE protein protein neigo Neisseria gonorrhoeae MSLIELLFGRKQKTATVARDRLQIIIAQERAQEGQTPDYLPTLRKELMEVLSKYVNVSLDNIRISQEKQDGMDVLELNITLPEQKKV q9ag19_neigo Cell division inhibitor MinD E8M63_02800 WHOF_00561 WHOF_02109C minD minD_1 WHOM_01818 minD_2 WHOM_02201 Septum site-determining protein MinD protein protein neigo Neisseria gonorrhoeae MAKIIVVTSGKGGVGKTTTSASIATGLALRGYKTAVIDFDVGLRNLDLIMGCERRVVYDLINVIQGEATLNQALIKDKNCENLFILPASQTRDKDALTREGVEKVMQELSGKKMGFEYIICDSPAGIEQGALMALYFADEAIVTTNPEVSSVRDSDRILGILQSKSRKAEQGGSVKEHLLITRYSPERVAKGEMLSVQDICDILRIPLLGVIPESQNVLQASNSGEPVIHQDSVAASEAYKDVIARLLGENREMRFLEAEKKSFFKRLFGG mine-1 3215810 N/A 3215814 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mind-mine-5 3215811 N/A 3215815 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3215814 unspecified role unspecified role unspecified role unspecified role P58152:p.Ala18Asp A18D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P58152:p.Leu22Asp L22D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P58152:p.Arg19Ala R19A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P58152:p.Arg21Ala R21A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mine-2 3215812 N/A 3215814 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mind-mine-6 3215813 N/A 3215815 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli N/A 3215814 enzyme regulator enzyme regulator unspecified role unspecified role P58152:p.Arg21Ala R21A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Region 1-22 Region 1-22 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P58152:p.Ile25Arg I25R/A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P58152:p.Leu22Asp L22D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P58152:p.Leu22Ala L22A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P58152:p.Ile25Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false