DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mapes-2010-1 caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Mapes J., Chen JT., Yu JS., Xue D. DIP original experiment: DIP-220064X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Somatic sex determination in Caenorhabditis elegans is modulated by SUP-26 repression of tra-2 translation. Mapes J., Chen JT., Yu JS., Xue D. Only protein-protein interactions imex curation mapes-2010-2 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Mapes J., Chen JT., Yu JS., Xue D. DIP original experiment: DIP-220065X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Somatic sex determination in Caenorhabditis elegans is modulated by SUP-26 repression of tra-2 translation. Mapes J., Chen JT., Yu JS., Xue D. Only protein-protein interactions imex curation q7k797_caeel pab-1 CELE_Y106G6H.2 Y106G6H.2 protein protein caeel Caenorhabditis elegans MEMNVAAPAAAVAGAAAPQPGQNQTGSSYTMASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMTVEGKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQGVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTDENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQRLASMRMHGNVPGAAMYNPTQPGPGYYVANPMQQQRNFAGGQQMVRPGGRWGMQNQYPVQNQYMMAQGPGVYQNRMGRPQNQQGGPRGPPQQYNQVAQGGVRMQGPPRTQNPGVQQQNVPRPPQQQQQQRPAPTGPKAPPQPYQAYQQRPQGIVIGGQEPLTSAMLAAAAPQEQKQLLGERIYALIEKLYPGHKDAGKITGMMLEIDNSELIMMLQDSELFRSKVDEAASVLVSAQKQ The sequence has been withdrawn from uniprot. q7jmb8_caeel sup-26 CELE_R10E4.2 R10E4.2 protein protein caeel Caenorhabditis elegans MNASSAPQQQQQQQQPQQGQAPQQQQQGPPQHQYQQQRPFHGRVQNHMRGSGPFGNSNGYGRYTAPRGDQQHHDSTPLSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTEGVQAQMAKLQQQEQDPTNLYIANLPLDFTEQMLETELNKFGMVISTRILRTPDNQSRGVGFARMDSKEKCEVIISALNGGRFDTMSKEGPALLIKQADTGRKSKHSMNNPEMLQRMQYPQVYQSYYGYHPAAVYQQHYDVNSLASQMGGMHVGGGNPQANGGGDMYGAHMYGQNAGGQGGQGVGQGGQGGNQQFYNPNNGRNKKYFQPMNPQ sup_26-pab_1-1 3215459 N/A 3215461 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3215462 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false caeel Caenorhabditis elegans physical association physical association false false false sup_26-pab_1-2 3215460 N/A 3215461 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3215462 unspecified role unspecified role bait bait C-terminal domain Region 260-357 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false