DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chen-2010-25 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. DIP original experiment: DIP-217664X Nature structural & molecular biology 2010 IMEx Structure of the Dom34-Hbs1 complex and implications for no-go decay. Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. Only protein-protein interactions imex curation chen-2010-26 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. DIP original experiment: DIP-217667X Nature structural & molecular biology 2010 IMEx Structure of the Dom34-Hbs1 complex and implications for no-go decay. Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. Only protein-protein interactions imex curation chen-2010-27 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. DIP original experiment: DIP-217665X Nature structural & molecular biology 2010 IMEx Structure of the Dom34-Hbs1 complex and implications for no-go decay. Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. Only protein-protein interactions imex curation chen-2010-28 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. DIP original experiment: DIP-217668X Nature structural & molecular biology 2010 IMEx Structure of the Dom34-Hbs1 complex and implications for no-go decay. Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. Only protein-protein interactions imex curation chen-2010-29 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. DIP original experiment: DIP-217666X Nature structural & molecular biology 2010 IMEx Structure of the Dom34-Hbs1 complex and implications for no-go decay. Chen L., Muhlrad D., Hauryliuk V., Cheng Z., Lim MK., Shyp V., Parker R., Song H. Only protein-protein interactions imex curation dom34_schpo Protein dom34 dom34 SPCC18B5.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MKLIQKNIEKNGSGWITMCPEEPEDMWHLYNILQVGDQLKASTVRRVVKVGATGSTSGSRVVMKLRILVENMDFDTKAAQLHIKGRTTEYHPEVKMGSYHTLDLELHRNFTLYKNEWDAFALDRVDAACNPSRNAEIGAVVLDEGLANICLITDYMTILRQRIDQVIPRKRRGDSSAYQKGLDKFYDSVFQSINSEFDFDKLKVVILASPGFVARGLYDYIFSMAVKLDLKQIVKSKNKFVILHSSTGHIHSLNEILKDPAVESKLADTKYVQEIRVLNKFYDVMNEDDRKAWYGPNHVLKAFELGAIGELLISDSLFRSSDIATRKKWVSLVEGVKEINCPVYIFSSLHESGKQLDLLSGIAAILTYPVDEEDISEDEEDEESQNFEHS 225978CC3D8F8E64 hbs1_schpo Elongation factor 1 alpha-like protein hbs1 SPBC25B2.01 SPBC2G5.08 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSRHRDVKNLDLDDYELDEEPGEEELTEEQEEEFRSAVATVRETLLGVPISEKEIADTVWYYYFDVEKSVNYLLQKASSKAGAKEKQNTDSQKEKKQNKSKEALADAKDPLDESSNGIKNLSLNKNDEPAFQTNGEVKMKNSSESDNQPEKKKIKKQNPTDLVSVPEIFEQSNPKPVVHLVVTGHVDSGKSTMLGRIMFELGEINSRSMQKLHNEAANSGKGSFSYAWLLDTTEEERARGVTMDVASTTFESDKKIYEIGDAPGHRDFISGMIAGASSADFAVLVVDSSQNNFERGFLENGQTREHAYLLRALGISEIVVSVNKLDLMSWSEDRFQEIKNIVSDFLIKMVGFKTSNVHFVPISAISGTNLIQKDSSDLYKWYKGPTLLSALDQLVPPEKPYRKPLRLSIDDVYRSPRSVTVTGRVEAGNVQVNQVLYDVSSQEDAYVKNVIRNSDPSSTWAVAGDTVTLQLADIEVNQLRPGDILSNYENPVRRVRSFVAEIQTFDIHGPILSGSTLVLHLGRTVTSVSLKIVTVNNKRSRHIASRKRALVRISFLDGLFPLCLAEECPALGRFILRRSGDTVAAGIVKELC 44BE2B324C97B455 hbs1-dom34-2 3215414 N/A 3215419 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3215420 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false dom34-hbs1-1 3215415 N/A 3215419 unspecified role unspecified role unspecified role unspecified role Q9USL5:p.Arg162Ala R162A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9USL5:p.Asp164Ala D164A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3215420 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dom34-hbs1-2 3215416 N/A 3215419 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3215420 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dom34-hbs1-3 3215417 N/A 3215419 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3215420 unspecified role unspecified role unspecified role unspecified role O74774:p.Asp411Ala D411A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O74774:p.Arg480Ala R480A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O74774:p.Arg523Ala R523A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O74774:p.Lys531Ala K531A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O74774:p.Arg541Ala R541A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O74774:p.Asp557Ala D557A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dom34-hbs1-4 3215418 N/A 3215419 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3215420 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false