DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ watt-2010-1 bovin Bos taurus (Bovine) Bovine x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Watt IN., Montgomery MG., Runswick MJ., Leslie AG., Walker JE. DIP original experiment: DIP-220012X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Bioenergetic cost of making an adenosine triphosphate molecule in animal mitochondria. Watt IN., Montgomery MG., Runswick MJ., Leslie AG., Walker JE. Only protein-protein interactions imex curation watt-2010-2 bovin Bos taurus (Bovine) Bovine ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Watt IN., Montgomery MG., Runswick MJ., Leslie AG., Walker JE. DIP original experiment: DIP-220013X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Bioenergetic cost of making an adenosine triphosphate molecule in animal mitochondria. Watt IN., Montgomery MG., Runswick MJ., Leslie AG., Walker JE. Only protein-protein interactions imex curation atp5e_bovin ATP synthase subunit epsilon, mitochondrial ATP5F1E ATP synthase F1 subunit epsilon ATP5E protein protein bovin Bos taurus (Bovine) Bovine MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAMKTSGSTIKIVKVKKE mint Mitochondrial membrane ATP synthase (F(1)F(O) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits atpg_bovin ATP synthase subunit gamma, mitochondrial ATP5F1C ATP synthase F1 subunit gamma ATP5C ATP5C1 F-ATPase gamma subunit protein protein bovin Bos taurus (Bovine) Bovine MFSRAGVAGLSAWTVQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVGSLALYEKADIKTPEDKKKHLIIGVSSDRGLCGAIHSSVAKQMKSEAANLAAAGKEVKIIGVGDKIRSILHRTHSDQFLVTFKEVGRRPPTFGDASVIALELLNSGYEFDEGSIIFNRFRSVISYKTEEKPIFSLDTISSAESMSIYDDIDADVLRNYQEYSLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD mint Mitochondrial membrane ATP synthase (F(1)F(O) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits at5g1_bovin ATP synthase F(0) complex subunit C1, mitochondrial ATP5MC1 ATP synthase lipid-binding protein ATP synthase membrane subunit c locus 1 ATP synthase proteolipid P1 ATP5G1 ATPase protein 9 ATPase subunit c protein protein bovin Bos taurus (Bovine) Bovine MQTTGALLISPALIRSCTRGLIRPVSASFLSRPEIQSVQPSYSSGPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM atpd_bovin ATP synthase subunit delta, mitochondrial ATP5F1D ATP synthase F1 subunit delta ATP5D F-ATPase delta subunit protein protein bovin Bos taurus (Bovine) Bovine MLPSALLRRPGLGRLVRQVRLYAEAAAAQAPAAGPGQMSFTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKALE atpb_bovin ATP synthase subunit beta, mitochondrial ATP5F1B ATP synthase F1 subunit beta ATP5B protein protein bovin Bos taurus (Bovine) Bovine MLGLVGRVVAASASGALRGLSPSAPLPQAQLLLRAAPAALQPARDYAAQASPSPKAGATTGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHLGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHS atpa_bovin ATP synthase subunit alpha, mitochondrial ATP5F1A ATP synthase F1 subunit alpha ATP5A1 ATP5A2 protein protein bovin Bos taurus (Bovine) Bovine MLSVRVAAAVARALPRRAGLVSKNALGSSFIAARNLHASNSRLQKTGTAEVSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLSKIRTDGKISEESDAKLKEIVTNFLAGFEA atp5a1-atp5b-12 3214538 N/A 3214540 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3214541 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3214542 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3214543 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3214544 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3214545 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine physical association physical association false false false atp5a1-atp5b-13 3214539 N/A 3214540 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3214541 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3214542 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3214543 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3214544 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3214545 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine association association false false false