DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hoadley-2010-1 chick Gallus gallus (Chicken) Chicken anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. DIP original experiment: DIP-217174X Structure (London, England : 1993) 2010 IMEx Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome. Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. Only protein-protein interactions imex curation hoadley-2010-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. DIP original experiment: DIP-217170X Structure (London, England : 1993) 2010 IMEx Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome. Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. Only protein-protein interactions imex curation hoadley-2010-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. DIP original experiment: DIP-217173X Structure (London, England : 1993) 2010 IMEx Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome. Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. Only protein-protein interactions imex curation hoadley-2010-4 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. DIP original experiment: DIP-217176X Structure (London, England : 1993) 2010 IMEx Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome. Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. Only protein-protein interactions imex curation hoadley-2010-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. DIP original experiment: DIP-217171X Structure (London, England : 1993) 2010 IMEx Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome. Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. Only protein-protein interactions imex curation hoadley-2010-6 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. DIP original experiment: DIP-217175X Structure (London, England : 1993) 2010 IMEx Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome. Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. Only protein-protein interactions imex curation hoadley-2010-7 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. DIP original experiment: DIP-217172X Structure (London, England : 1993) 2010 IMEx Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome. Hoadley KA., Xu D., Xue Y., Satyshur KA., Wang W., Keck JL. Only protein-protein interactions imex curation q4w5x0_chick DNA topoisomerase TOP3A protein protein chick Gallus gallus (Chicken) Chicken MNFQARLLASCGVRMLPQPWRGFSRAAEGPAVQRIRKVLCVAEKNDAARGIADLLSNSRMRRREGFSKFNKIYEYDYQMFGQNVTMVMTSVSGHLLAHDFKLPFRKWHSCNPLALFDAEIEKYCPENYVDIKRTLEREVQQCQALVIWTDCDREGENIGFEIIHVCKAVKPNLQVFRARFSEITLHAVRRACENLTQPDQKTSDAVEVRQELDLRIGAAFTRFQTLRLQKIFPDILADQLISYGSCQFPTLGFVVERFKAIQAFVPEAFYKIKVTHDHEDGNVVFNWKRNRLFNHTACLVLYHMCMEDPIATVVEVGSKPKSKWRPLPLDTVELEKLASRKLKINAKETMRIAEKLYTQGFISYPRTETNIFPKELNLSALVQHQTQDPNWGAFAQRILDQGGPTPRNGTKSDQAHPPIHPTKYTANLQGNEQRLYEFIVRHFLACCSQDAKGQETTVEIDIANERFVAQGLMILARNYLEVYPYEKWSDKVIPLYQKGSRFQPTTVEMVDGETSPPLLLTEADLIALMEKHGIGTDATHAEHIETIKTRMYVGLTADQRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKKDKSIVLHQQVQKYKQVFIEAVARANKLDQALAQYFGEATEIVEQEEVYPAMPVSIRKCPQCNNDMVLKTKKNGGFYLSCTGYPACKTAVWFPDFVLDVAKDESICAVCKPHPVHRLKFKFKRGSVPPTMPLDFVGCIGGCDQMLKELLDLRYSHRSSQSGQSASQQANQLQVNNSFNRANSENRRVGGTTNMATGHLLYLSSTRAPRPAPSAAPDDGNNAVVCNCGNEAMLLTVRKEGPNQGRQFYKCSANTCNFFLWSDQQSEDRSNAAPRGSAPPRAFGARGPANSQRPGGKRGPEHFGSSNNSSSGDSTVCRCDQPAVTRTVQKDGPNKGRQFHTCSKPREQQCGFFQWADENVAPGASGDFSFNHFGSSEYSRELGSKAKRPSNLSHGATAKKPRTCSICHQPGHTKKTCPLDH q96e14-1 RecQ-mediated genome instability protein 2 RMI2 C16orf75 BLM-associated protein of 18 kDa protein protein human Homo sapiens Human MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP rmi1_human RecQ-mediated genome instability protein 1 BLM-associated protein of 75 kDa FAAP75 RMI1 C9orf76 protein protein human Homo sapiens Human MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDLVVSVIPNNSNENIPRVTDVLDPALGPSDEELLASLDENDELTANNDTSSERCFTTGSSSNTIPTRQSSFEPEFVISPRPKEEPSNLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIERFSHNPNTTNNFSLTCKNGNNNWSEKNVSEQMTNEDKSFGCPSVRDQNRSIFSVHCNVPLAHDFTNKEKNLETDNKIKQTSSSDSHSLNNKILNREVVNYVQKRNSQISNENDCNLQSCSLRSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK blm_human Bloom syndrome protein RecQ protein-like 3 DNA helicase, RecQ-like type 2 BLM RECQ2 RECQL3 protein protein human Homo sapiens Human MAAVPQNNLQEQLERHSARTLNNKLSLSKPKFSGFTFKKKTSSDNNVSVTNVSVAKTPVLRNKDVNVTEDFSFSEPLPNTTNQQRVKDFFKNAPAGQETQRGGSKSLLPDFLQTPKEVVCTTQNTPTVKKSRDTALKKLEFSSSPDSLSTINDWDDMDDFDTSETSKSFVTPPQSHFVRVSTAQKSKKGKRNFFKAQLYTTNTVKTDLPPPSSESEQIDLTEEQKDDSEWLSSDVICIDDGPIAEVHINEDAQESDSLKTHLEDERDNSEKKKNLEEAELHSTEKVPCIEFDDDDYDTDFVPPSPEEIISASSSSSKCLSTLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSVSPGDCLLTTTLGKTGFSATRKNLFERPLFNTHLQKSFVSSNWAETPRLGKKNESSYFPGNVLTSTAVKDQNKHTASINDLERETQPSYDIDNFDIDDFDDDDDWEDIMHNLAASKSSTAAYQPIKEGRPIKSVSERLSSAKTDCLPVSSTAQNINFSESIQNYTDKSAQNLASRNLKHERFQSLSFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPATYLTGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETENSSSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDSSPGISLSSSRGPGRSAAEELDEEIPVSSHYFASKTRNERKRKKMPASQRSKRRKTASSGSKAKGGSATCRKISSKTKSSSIIGSSSASHTSQATSGANSKLGIMAPPKPINRPFLKPSYAFS top3a_human DNA topoisomerase 3-alpha DNA topoisomerase III alpha TOP3A TOP3 protein protein human Homo sapiens Human MIFPVARYALRWLRRPEDRAFSRAAMEMALRGVRKVLCVAEKNDAAKGIADLLSNGRMRRREGLSKFNKIYEFDYHLYGQNVTMVMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEKYCPENFVDIKKTLERETRQCQALVIWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSEITPHAVRTACENLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQRIFPEVLAEQLISYGSCQFPTLGFVVERFKAIQAFVPEIFHRIKVTHDHKDGIVEFNWKRHRLFNHTACLVLYQLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGYISYPRTETNIFPRDLNLTVLVEQQTPDPRWGAFAQSILERGGPTPRNGNKSDQAHPPIHPTKYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLMILARNYLDVYPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLTPDKRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKKDKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYFGNGTELAQQEDIYPAMPEPIRKCPQCNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSVLEASRDSSVCPVCQPHPVYRLKLKFKRGSLPPTMPLEFVCCIGGCDDTLREILDLRFSGGPPRASQPSGRLQANQSLNRMDNSQHPQPADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNGGSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCSQPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLESEARSKRPRASSSDMGSTAKKPRKCSLCHQPGHTRPFCPQNR rmi2-top3a-1 3214132 N/A 3214139 unspecified role unspecified role prey prey chick Gallus gallus (Chicken) Chicken N/A 3214140 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q96E14-1:p.Asp141Ala D141A/K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q96E14-1:p.[Lys121Glu;Asp141Lys] K121E/D141K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96E14-1:p.Asp141Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false chick Gallus gallus (Chicken) Chicken physical association physical association false false false rmi1-rmi2-1 3214133 N/A 3214141 unspecified role unspecified role unspecified role unspecified role OB2 domain Region 473-625 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3214140 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rmi2-blm-1 3214134 N/A 3214142 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3214143 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3214141 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3214140 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q96E14-1:p.Asp141Ala D141A/K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q96E14-1:p.[Lys121Glu;Asp141Lys] K121E/D141K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q96E14-1:p.Lys121Glu K121E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q96E14-1:p.Asp141Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human association association false false false rmi2-rmi1-1 3214135 N/A 3214141 unspecified role unspecified role prey prey OB2 domain Region 473-625 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3214140 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false rmi1-rmi2-2 3214136 N/A 3214141 unspecified role unspecified role unspecified role unspecified role OB2 domain Region 473-625 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3214140 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rmi1-rmi2-3 3214137 N/A 3214141 unspecified role unspecified role bait bait OB2 domain Region 473-625 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3214140 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false rmi1-rmi2-4 3214138 N/A 3214141 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3214140 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false