DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tanaka-2010-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Tanaka R., Rothbart M., Oka S., Takabayashi A., Takahashi K., Shibata M., Myouga F., Motohashi R., Shinozaki K., Grimm B., Tanaka A. DIP original experiment: DIP-219995X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx LIL3, a light-harvesting-like protein, plays an essential role in chlorophyll and tocopherol biosynthesis. Tanaka R., Rothbart M., Oka S., Takabayashi A., Takahashi K., Shibata M., Myouga F., Motohashi R., Shinozaki K., Grimm B., Tanaka A. Only protein-protein interactions imex curation tanaka-2010-3 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Tanaka R., Rothbart M., Oka S., Takabayashi A., Takahashi K., Shibata M., Myouga F., Motohashi R., Shinozaki K., Grimm B., Tanaka A. DIP original experiment: DIP-219998X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx LIL3, a light-harvesting-like protein, plays an essential role in chlorophyll and tocopherol biosynthesis. Tanaka R., Rothbart M., Oka S., Takabayashi A., Takahashi K., Shibata M., Myouga F., Motohashi R., Shinozaki K., Grimm B., Tanaka A. Only protein-protein interactions imex curation tanaka-2010-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Tanaka R., Rothbart M., Oka S., Takabayashi A., Takahashi K., Shibata M., Myouga F., Motohashi R., Shinozaki K., Grimm B., Tanaka A. DIP original experiment: DIP-219996X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx LIL3, a light-harvesting-like protein, plays an essential role in chlorophyll and tocopherol biosynthesis. Tanaka R., Rothbart M., Oka S., Takabayashi A., Takahashi K., Shibata M., Myouga F., Motohashi R., Shinozaki K., Grimm B., Tanaka A. Only protein-protein interactions imex curation tanaka-2010-5 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Tanaka R., Rothbart M., Oka S., Takabayashi A., Takahashi K., Shibata M., Myouga F., Motohashi R., Shinozaki K., Grimm B., Tanaka A. DIP original experiment: DIP-219997X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx LIL3, a light-harvesting-like protein, plays an essential role in chlorophyll and tocopherol biosynthesis. Tanaka R., Rothbart M., Oka S., Takabayashi A., Takahashi K., Shibata M., Myouga F., Motohashi R., Shinozaki K., Grimm B., Tanaka A. Only protein-protein interactions imex curation lil31_arath Light-harvesting complex-like protein 3 isotype 1, chloroplastic LIL3.1 LHC-like protein 3 isoform 1 dl4835w At4g17600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MALFSPPISSSSLQNPNFIPKFSFSLLSSNRFSLLSVTRASSDSGSTSPTAAVSVEAPEPVEVIVKEPPQSTPAVKKEETATAKNVAVEGEEMKTTESVVKFQDARWINGTWDLKQFEKDGKTDWDSVIVAEAKRRKWLEENPETTSNDEPVLFDTSIIPWWAWIKRYHLPEAELLNGRAAMIGFFMAYFVDSLTGVGLVDQMGNFFCKTLLFVAVAGVLFIRKNEDVDKLKNLFDETTLYDKQWQAAWKNDDDESLGSKKK chlp_arath Geranylgeranyl diphosphate reductase, chloroplastic Geranylgeranyl reductase CHLP F1M20.15 At1g74470 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATTVTLKSFTGLRQSSTEQTNFVSHVPSSLSLPQRRTSLRVTAARATPKLSNRKLRVAVIGGGPAGGAAAETLAQGGIETILIERKMDNCKPCGGAIPLCMVGEFNLPLDIIDRRVTKMKMISPSNIAVDIGRTLKEHEYIGMVRREVLDAYLRERAEKSGATVINGLFLKMDHPENWDSPYTLHYTEYDGKTGATGTKKTMEVDAVIGADGANSRVAKSIDAGDYDYAIAFQERIRIPDEKMTYYEDLAEMYVGDDVSPDFYGWVFPKCDHVAVGTGTVTHKGDIKKFQLATRNRAKDKILGGKIIRVEAHPIPEHPRPRRLSKRVALVGDAAGYVTKCSGEGIYFAAKSGRMCAEAIVEGSQNGKKMIDEGDLRKYLEKWDKTYLPTYRVLDVLQKVFYRSNPAREAFVEMCNDEYVQKMTFDSYLYKRVAPGSPLEDIKLAVNTIGSLVRANALRREIEKLSV lil32_arath Light-harvesting complex-like protein 3 isotype 2, chloroplastic LIL3.2 LHC-like protein 3 isoform 2 K14A3.6 At5g47110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSISMALFSPPISSSLQNPNLIPKISTSLLSTKRFSLISVPRASSDNGTTSPVVEIPKPASVAVEEVPVKSPAESSSASENGAVGGEATDSSTETVIKYQNAKWVNGTWDLKQFEKDGKTDWDSVIVSEAKRRKWLEDNPETTSNDELVVFDTSIIPWWAWMKRYHLPEAELLNGRAAMIGFFMAYFVDSLTGVGLVDQMGNFFCKTLLFVAVAGVLFIRKNEDLDKLKDLFDETTLYDKQWQAAWKEPDSSTVSSKK lil3.1-chlp-1 3214042 N/A 3214046 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3214047 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false chlp-lil3.2-1 3214043 N/A 3214048 unspecified role unspecified role unspecified role unspecified role C-terminal domain of Venus Venus-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana N/A 3214047 unspecified role unspecified role unspecified role unspecified role N-terminal domain of Venus Venus-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana direct interaction direct interaction false false false lil3.2-chlp-1 3214044 N/A 3214048 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3214047 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false chlp-lil3.1-1 3214045 N/A 3214046 unspecified role unspecified role unspecified role unspecified role C-terminal domain of Venus Venus-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana N/A 3214047 unspecified role unspecified role unspecified role unspecified role N-terminal domain of Venus Venus-tag fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana direct interaction direct interaction false false false