DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ jehle-2010-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Jehle S., Rajagopal P., Bardiaux B., Markovic S., Kühne R., Stout JR., Higman VA., Klevit RE., van Rossum BJ., Oschkinat H. DIP original experiment: DIP-217642X Nature structural & molecular biology 2010 IMEx Solid-state NMR and SAXS studies provide a structural basis for the activation of alphaB-crystallin oligomers. Jehle S., Rajagopal P., Bardiaux B., Markovic S., Kühne R., Stout JR., Higman VA., Klevit RE., van Rossum BJ., Oschkinat H. Only protein-protein interactions imex curation jehle-2010-2 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Jehle S., Rajagopal P., Bardiaux B., Markovic S., Kühne R., Stout JR., Higman VA., Klevit RE., van Rossum BJ., Oschkinat H. DIP original experiment: DIP-217643X Nature structural & molecular biology 2010 IMEx Solid-state NMR and SAXS studies provide a structural basis for the activation of alphaB-crystallin oligomers. Jehle S., Rajagopal P., Bardiaux B., Markovic S., Kühne R., Stout JR., Higman VA., Klevit RE., van Rossum BJ., Oschkinat H. Only protein-protein interactions imex curation cryab_human Alpha-crystallin B chain CRYAB CRYA2 Renal carcinoma antigen NY-REN-27 Alpha(B)-crystallin Rosenthal fiber component Heat shock protein beta-5 HSPB5 protein protein human Homo sapiens Human MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK AE08BED46B7849CB cryab-8 3213433 N/A 3213435 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cryab-9 3213434 N/A 3213435 unspecified role unspecified role unspecified role unspecified role Alpha-crystallin domain Region 64-152 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false