DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ arold-2010-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Arold ST., Leonard PG., Parkinson GN., Ladbury JE. DIP original experiment: DIP-219957X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx H-NS forms a superhelical protein scaffold for DNA condensation. Arold ST., Leonard PG., Parkinson GN., Ladbury JE. Only protein-protein interactions imex curation arold-2010-2 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Arold ST., Leonard PG., Parkinson GN., Ladbury JE. DIP original experiment: DIP-219958X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx H-NS forms a superhelical protein scaffold for DNA condensation. Arold ST., Leonard PG., Parkinson GN., Ladbury JE. Only protein-protein interactions imex curation hns_salty DNA-binding protein H-NS hns Histone-like protein HLP-II Protein B1 Protein H1 hnsA osmZ STM1751 protein protein salty Salmonella typhimurium MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSMAAAKSGTKAKRAARPAKYSYVDENGETKTWTGQGRTPAVIKKAMEEQGKQLEDFLIKE A9620E5CC7DD3EB1 h_ns-1 3213357 N/A 3213359 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-83 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false h_ns-2 3213358 N/A 3213359 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-83 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false