DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ rao-2010-9 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219406X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions imex curation rao-2010-10 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219413X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions imex curation rao-2010-11 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219409X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions imex curation rao-2010-12 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219412X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions imex curation rao-2010-13 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219408X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions imex curation rao-2010-14 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219407X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions imex curation rao-2010-15 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219411X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions imex curation rao-2010-16 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. DIP original experiment: DIP-219410X Nature 2010 IMEx IkappaBbeta acts to inhibit and activate gene expression during the inflammatory response. Rao P., Hayden MS., Long M., Scott ML., West AP., Zhang D., Oeckinghaus A., Lynch C., Hoffmann A., Baltimore D., Ghosh S. Only protein-protein interactions imex curation tf65_mouse Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Rela Nfkb3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein mouse Mus musculus Mouse MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS rel_mouse Proto-oncogene c-Rel Rel protein protein mouse Mus musculus Mouse MASSGYNPYVEIIEQPRQRGMRFRYKCEGRSAGSIPGERSTDNNRTYPSVQIMNYYGKGKIRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGPERRPLFFQNLGIRCVKKKEVKGAIILRISAGINPFNVGEQQLLDIEDCDLNVVRCVFMFFLPDEDGNFTTALPPIVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEARGVFSQADVHRQVAIVFKTPPYCKAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQDCGHFTEKPRTAPLGSTGEGRFIKKESNLFSHGTVLPEMPRSSGVPGQAEPYYSSCGSISSGLPHHPPAIPSVAHQPTSWPPVTHPTSHPVSTNTLSTFSAGTLSSNSQGILPFLEGPGVSDLSASNSCLYNPDDLARMETPSMSPTDLYSISDVNMLSTRPLSVMAPSTDGMGDTDNPRLVSINLENPSCNARLGPRDLRQLHQMSPASLSAGTSSSSVFVSQSDAFDRSNFSCVDNGLMNEPGLSDDANNPTFVQSSHYSVNTLQSEQLSDPFTYGFFKI ikbb_mouse NF-kappa-B inhibitor beta I-kappa-B-beta Nfkbib Ikbb protein protein mouse Mus musculus Mouse MAGVACLGKTADADEWCDSGLGSLGPDAAAPGGPGLGAELGPELSWAPLVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILARLLRAHGAPEPEDEDDKLSPCSSSGSDSDSDNRDEGDEYDDIVVHSGRSQNRQPPSPASKPLPDDPNPA ikba_mouse NF-kappa-B inhibitor alpha I-kappa-B-alpha Nfkbia Ikba protein protein mouse Mus musculus Mouse MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAPLAAEPWKQQLTEDGDSFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVITNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATNYNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDDCVFGGQRLTL p25799-1 Nuclear factor NF-kappa-B p105 subunit p105 Nfkb1 DNA-binding factor KBF1 EBP-1 NF-kappa-B1 p84/NF-kappa-B1 p98 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein mouse Mus musculus Mouse MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHGTINTKFKNGPKDCAKSDDEESLTLPEKETEGEGPSLPMACTKTEPIALASTMEDKEQDMGFQDNLFLEKALQLARRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRVGADLSLLDRWGNSVLHLAAKEGHDRILSILLKSRKAAPLIDHPNGEGLNAIHIAVMSNSLPCLLLLVAAGAEVNAQEQKSGRTALHLAVEYDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKAGEDEGVVPGTTPLDMAANWQVFDILNGKPYEPVFTSDDILPQGDMKQLTEDTRLQLCKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVTTAQVHCLPLSSSSTRQHIDELRDSDSVCDSGVETSFRKLSFTESLTGDSPLLSLNKMPHGYGQEGPIEGKI nfkbib-rel-1 3213245 N/A 3213253 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3213254 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3213255 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association false false false rela-nfkbib-10 3213246 N/A 3213253 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3213254 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3213255 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false rel-nfkb1-1 3213247 N/A 3213256 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3213257 unspecified role unspecified role prey prey Nuclear factor NF-kappa-B p50 subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3213253 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3213254 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3213255 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false rel-nfkbib-1 3213248 N/A 3213254 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3213255 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false rela-nfkb1-11 3213249 N/A 3213257 unspecified role unspecified role prey prey Nuclear factor NF-kappa-B p50 subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3213253 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3213254 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3213255 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false rela-nfkb1-16 3213250 N/A 3213256 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3213257 unspecified role unspecified role prey prey Nuclear factor NF-kappa-B p50 subunit Region 1-431 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3213253 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3213254 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3213255 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false rel-nfkbib-2 3213251 N/A 3213253 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3213254 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3213255 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false rel-nfkbia-1 3213252 N/A 3213256 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3213253 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3213254 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3213255 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false