DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ makde-2010-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Makde RD., England JR., Yennawar HP., Tan S. DIP original experiment: DIP-219346X Nature 2010 IMEx Structure of RCC1 chromatin factor bound to the nucleosome core particle. Makde RD., England JR., Yennawar HP., Tan S. Only protein-protein interactions imex curation makde-2010-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Makde RD., England JR., Yennawar HP., Tan S. DIP original experiment: DIP-219350X Nature 2010 IMEx Structure of RCC1 chromatin factor bound to the nucleosome core particle. Makde RD., England JR., Yennawar HP., Tan S. Only protein-protein interactions imex curation makde-2010-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Makde RD., England JR., Yennawar HP., Tan S. DIP original experiment: DIP-219349X Nature 2010 IMEx Structure of RCC1 chromatin factor bound to the nucleosome core particle. Makde RD., England JR., Yennawar HP., Tan S. Only protein-protein interactions imex curation makde-2010-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Makde RD., England JR., Yennawar HP., Tan S. DIP original experiment: DIP-219348X Nature 2010 IMEx Structure of RCC1 chromatin factor bound to the nucleosome core particle. Makde RD., England JR., Yennawar HP., Tan S. Only protein-protein interactions imex curation makde-2010-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Makde RD., England JR., Yennawar HP., Tan S. DIP original experiment: DIP-219351X Nature 2010 IMEx Structure of RCC1 chromatin factor bound to the nucleosome core particle. Makde RD., England JR., Yennawar HP., Tan S. Only protein-protein interactions imex curation makde-2010-6 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Makde RD., England JR., Yennawar HP., Tan S. DIP original experiment: DIP-219347X Nature 2010 IMEx Structure of RCC1 chromatin factor bound to the nucleosome core particle. Makde RD., England JR., Yennawar HP., Tan S. Only protein-protein interactions imex curation h2b11_xenla Histone H2B 1.1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK q6azj8_xenla Histone H2A h2ac14.L LOC494591 h2ac14 hist1h2aj XELAEV_18003602mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK h4_xenla Histone H4 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG h32_xenla Histone H3.2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA rcc1_drome Regulator of chromosome condensation Rcc1 Bj1 Chromatin-binding protein Bj1 Regulator of chromosome condensation 1 ortholog CG10480 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPRRKALTNNNNAGEAEQQPPKAKRARIAFHLELPKRRTVLGNVLVCGNGDVGQLGLGEDILERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGCNDEGALGRDTSEDGSESKPDLIDLPGKALCISAGDSHSACLLEDGRVFAWGSFRDSHGNMGLTIDGNKRTPIDLMEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRGKRDLLRPTQLIITRAKPFEAIWATNYCTFMRESQTQVIWATGLNNFKQLAHETKGKEFALTPIKTELKDIRHIAGGQHHTVILTTDLKCSVVGRPEYGRLGLGDVKDVVEKPTIVKKLTEKIVSVGCGEVCSYAVTIDGKLYSWGSGVNNQLGVGDGDDELEPIVVVSKNTQGKHMLLASGGGQHAIFLVKADKQDQKENVPVKVSGSSSISKKDKTPPQDNVDKEAENVDKQEQKENLPAKASTSSKKNKTPPQDNADKEAENVDKQEQKENLPAKASTSSKKIKTPPQDDAAEEVEEESAQEPTPKKAKKPAAKRGGKKT rcc1_human Regulator of chromosome condensation Chromosome condensation protein 1 Cell cycle regulatory protein RCC1 CHC1 protein protein human Homo sapiens Human MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS h2b11_xenla-h32_xenla-1 3213164 N/A 3213170 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3213171 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3213172 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3213173 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3213174 unspecified role unspecified role unspecified role unspecified role Region 2-422 Region 2-422 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false h2b11_xenla-h32_xenla-2 3213165 N/A 3213175 unspecified role unspecified role prey prey Region 21-421 Region 21-421 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3213170 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3213171 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3213172 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3213173 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false h2b11_xenla-h32_xenla-3 3213166 N/A 3213170 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3213171 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3213172 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3213173 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false h2b11_xenla-h32_xenla-4 3213167 N/A 3213170 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3213171 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3213172 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3213173 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false h2b11_xenla-rcc1-1 3213168 N/A 3213175 unspecified role unspecified role prey prey Region 21-421 Region 21-421 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P18754:p.[Lys232Ala;Arg234Ala;Arg237Ala] K232A/R234A/R237A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P18754:p.Lys232Ala K232A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P18754:p.Arg237Ala R237A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P18754:p.Arg234Ala R234A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3213170 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false h2b11_xenla-h32_xenla-5 3213169 N/A 3213170 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3213171 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3213172 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3213173 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3213174 unspecified role unspecified role unspecified role unspecified role Region 2-422 Region 2-422 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false