DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ krishnan-2010-1 in vitro In vitro crosslink cross-linking study crosslink weight by staining molecular weight estimation by staining weight by staining Krishnan L., Li X., Naraharisetty HL., Hare S., Cherepanov P., Engelman A. DIP original experiment: DIP-219954X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure-based modeling of the functional HIV-1 intasome and its inhibition. Krishnan L., Li X., Naraharisetty HL., Hare S., Cherepanov P., Engelman A. Only protein-protein interactions imex curation a0a0u5b5j2_9hiv1 Integrase pol protein protein 9hiv1 Human immunodeficiency virus 1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED A39EF048DFDDB104 in-1 3213028 N/A 3213029 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false