DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ froidure-2010-1 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Froidure S., Canonne J., Daniel X., Jauneau A., Brière C., Roby D., Rivas S. DIP original experiment: DIP-221284X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx AtsPLA2-alpha nuclear relocalization by the Arabidopsis transcription factor AtMYB30 leads to repression of the plant defense response. Froidure S., Canonne J., Daniel X., Jauneau A., Brière C., Roby D., Rivas S. Only protein-protein interactions imex curation froidure-2010-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Froidure S., Canonne J., Daniel X., Jauneau A., Brière C., Roby D., Rivas S. DIP original experiment: DIP-221282X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx AtsPLA2-alpha nuclear relocalization by the Arabidopsis transcription factor AtMYB30 leads to repression of the plant defense response. Froidure S., Canonne J., Daniel X., Jauneau A., Brière C., Roby D., Rivas S. Only protein-protein interactions imex curation froidure-2010-3 nicbe Nicotiana benthamiana fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Froidure S., Canonne J., Daniel X., Jauneau A., Brière C., Roby D., Rivas S. DIP original experiment: DIP-221285X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx AtsPLA2-alpha nuclear relocalization by the Arabidopsis transcription factor AtMYB30 leads to repression of the plant defense response. Froidure S., Canonne J., Daniel X., Jauneau A., Brière C., Roby D., Rivas S. Only protein-protein interactions imex curation froidure-2010-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Froidure S., Canonne J., Daniel X., Jauneau A., Brière C., Roby D., Rivas S. DIP original experiment: DIP-221283X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx AtsPLA2-alpha nuclear relocalization by the Arabidopsis transcription factor AtMYB30 leads to repression of the plant defense response. Froidure S., Canonne J., Daniel X., Jauneau A., Brière C., Roby D., Rivas S. Only protein-protein interactions imex curation pla2a_arath Phospholipase A2-alpha PLA2-ALPHA Secretory phospholipase A2-alpha T4E14.19 At2g06925 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAPIILFSFLLFFSVSVSALNVGVQLIHPSISLTKECSRKCESEFCSVPPFLRYGKYCGLLYSGCPGERPCDGLDSCCMKHDACVQSKNNDYLSQECSQKFINCMNNFSQKKQPTFKGNKCDADEVIDVISIVMEAALIAGKVLKKP myb30_arath Transcription factor MYB30 MYB30 Myb-related protein 30 hsr1 MLD15.8 At3g28910 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVRPPCCDKGGVKKGPWTPEEDIILVTYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYLRPGIKRGNFTEHEEKMIVHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKLNKVNQDSHQELDRSSLSSSPSSSSANSNSNISRGQWERRLQTDIHLAKKALSEALSPAVAPIITSTVTTTSSSAESRRSTSSASGFLRTQETSTTYASSTENIAKLLKGWVKNSPKTQNSADQIASTEVKEVIKSDDGKECAGAFQSFSEFDHSYQQAGVSPDHETKPDITGCCSNQSQWSLFEKWLFEDSGGQIGDILLDENTNFF pla2_alpha-myb30-1 3212502 N/A 3212506 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3212507 unspecified role unspecified role prey prey TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana physical association physical association false false false myb30-pla2_alpha-1 3212503 N/A 3212506 unspecified role unspecified role prey prey Region 30-148 Region 30-148 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3212507 unspecified role unspecified role bait bait Region 1-234 Region 1-234 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false myb30-pla2_alpha-2 3212504 N/A 3212506 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Venus-tag Venus-tag venus venus fluorescent protein tag venus c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3212507 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 14-116 Region 14-116 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana direct interaction direct interaction false false false myb30-pla2_alpha-3 3212505 N/A 3212506 unspecified role unspecified role prey prey Region 30-148 Region 30-148 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3212507 unspecified role unspecified role bait bait Region 1-234 Region 1-234 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false