DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ radaev-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Radaev S., Zou Z., Tolar P., Nguyen K., Nguyen A., Krueger PD., Stutzman N., Pierce S., Sun PD. DIP original experiment: DIP-220687X Structure (London, England : 1993) 2010 IMEx Structural and functional studies of Igalphabeta and its assembly with the B cell antigen receptor. Radaev S., Zou Z., Tolar P., Nguyen K., Nguyen A., Krueger PD., Stutzman N., Pierce S., Sun PD. Only protein-protein interactions imex curation radaev-2010-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Radaev S., Zou Z., Tolar P., Nguyen K., Nguyen A., Krueger PD., Stutzman N., Pierce S., Sun PD. DIP original experiment: DIP-220690X Structure (London, England : 1993) 2010 IMEx Structural and functional studies of Igalphabeta and its assembly with the B cell antigen receptor. Radaev S., Zou Z., Tolar P., Nguyen K., Nguyen A., Krueger PD., Stutzman N., Pierce S., Sun PD. Only protein-protein interactions imex curation radaev-2010-3 ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Radaev S., Zou Z., Tolar P., Nguyen K., Nguyen A., Krueger PD., Stutzman N., Pierce S., Sun PD. DIP original experiment: DIP-220691X Structure (London, England : 1993) 2010 IMEx Structural and functional studies of Igalphabeta and its assembly with the B cell antigen receptor. Radaev S., Zou Z., Tolar P., Nguyen K., Nguyen A., Krueger PD., Stutzman N., Pierce S., Sun PD. Only protein-protein interactions imex curation radaev-2010-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Radaev S., Zou Z., Tolar P., Nguyen K., Nguyen A., Krueger PD., Stutzman N., Pierce S., Sun PD. DIP original experiment: DIP-220688X Structure (London, England : 1993) 2010 IMEx Structural and functional studies of Igalphabeta and its assembly with the B cell antigen receptor. Radaev S., Zou Z., Tolar P., Nguyen K., Nguyen A., Krueger PD., Stutzman N., Pierce S., Sun PD. Only protein-protein interactions imex curation radaev-2010-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Radaev S., Zou Z., Tolar P., Nguyen K., Nguyen A., Krueger PD., Stutzman N., Pierce S., Sun PD. DIP original experiment: DIP-220689X Structure (London, England : 1993) 2010 IMEx Structural and functional studies of Igalphabeta and its assembly with the B cell antigen receptor. Radaev S., Zou Z., Tolar P., Nguyen K., Nguyen A., Krueger PD., Stutzman N., Pierce S., Sun PD. Only protein-protein interactions imex curation radaev-2010-6 ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Radaev S., Zou Z., Tolar P., Nguyen K., Nguyen A., Krueger PD., Stutzman N., Pierce S., Sun PD. DIP original experiment: DIP-220692X Structure (London, England : 1993) 2010 IMEx Structural and functional studies of Igalphabeta and its assembly with the B cell antigen receptor. Radaev S., Zou Z., Tolar P., Nguyen K., Nguyen A., Krueger PD., Stutzman N., Pierce S., Sun PD. Only protein-protein interactions imex curation p40259-1 B-cell antigen receptor complex-associated protein beta chain B-cell-specific glycoprotein B29 Ig-beta Immunoglobulin-associated B29 protein CD79B B29 IGB protein protein human Homo sapiens Human MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE cd79b_mouse B-cell antigen receptor complex-associated protein beta chain Cd79b Igb B-cell-specific glycoprotein B29 Ig-beta Immunoglobulin-associated B29 protein protein protein mouse Mus musculus Mouse MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE cd79b-1 3212276 N/A 3212282 unspecified role unspecified role unspecified role unspecified role Extracellular domain Region 26-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cd79b-2 3212277 N/A 3212283 unspecified role unspecified role unspecified role unspecified role Extracellular domain Region 27-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cd79b-3 3212278 N/A 3212283 unspecified role unspecified role unspecified role unspecified role Extracellular domain Region 27-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli covalent binding covalent binding false false false cd79b-4 3212279 N/A 3212282 unspecified role unspecified role unspecified role unspecified role Extracellular domain Region 26-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cd79b-5 3212280 N/A 3212283 unspecified role unspecified role unspecified role unspecified role Extracellular domain Region 27-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cd79b-6 3212281 N/A 3212282 unspecified role unspecified role unspecified role unspecified role Extracellular domain Region 26-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli covalent binding covalent binding false false false