DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ preiss-2010-1 bacpe Bacillus pseudofirmus (strain OF4) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Preiss L., Yildiz O., Hicks DB., Krulwich TA., Meier T. DIP original experiment: DIP-216665X PLoS biology 2010 IMEx A new type of proton coordination in an F(1)F(o)-ATP synthase rotor ring. Preiss L., Yildiz O., Hicks DB., Krulwich TA., Meier T. Only protein-protein interactions imex curation atpl_alkpo ATP synthase subunit c atpE F-type ATPase subunit c Lipid-binding protein BpOF4_06875 ATP synthase F(0) sector subunit c protein protein bacpe Bacillus pseudofirmus (strain OF4) MAFLGAAIAAGLAAVAGAIAVAIIVKATIEGTTRQPELRGTLQTLMFIGVPLAEAVPIIAIVISLLILF atpe-1 3212259 N/A 3212260 unspecified role unspecified role unspecified role unspecified role bacpe Bacillus pseudofirmus (strain OF4) direct interaction direct interaction false false false