DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ qin-2010-1 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. DIP original experiment: DIP-221276X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. Only protein-protein interactions imex curation qin-2010-2 ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. DIP original experiment: DIP-221280X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. Only protein-protein interactions imex curation qin-2010-3 ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. DIP original experiment: DIP-221277X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. Only protein-protein interactions imex curation qin-2010-4 in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. DIP original experiment: DIP-221281X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. Only protein-protein interactions imex curation qin-2010-5 in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. DIP original experiment: DIP-221279X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. Only protein-protein interactions imex curation qin-2010-6 in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. DIP original experiment: DIP-221278X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Intermolecular associations determine the dynamics of the circadian KaiABC oscillator. Qin X., Byrne M., Mori T., Zou P., Williams DR., McHaourab H., Johnson CH. Only protein-protein interactions imex curation kaic_syne7 Circadian clock protein kinase KaiC see0011 kaiC Synpcc7942_1216 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MTSAEMTSPNNNSEHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGAMRLTQRSSNVRVSSGVVRLDEMCGGGFFKDSIILATGATGTGKTLLVSRFVENACANKERAILFAYEESRAQLLRNAYSWGMDFEEMERQNLLKIVCAYPESAGLEDHLQIIKSEINDFKPARIAIDSLSALARGVSNNAFRQFVIGVTGYAKQEEITGLFTNTSDQFMGAHSITDSHISTITDTIILLQYVEIRGEMSRAINVFKMRGSWHDKAIREFMISDKGPDIKDSFRNFERIISGSPTRITVDEKSELSRIVRGVQEKGPES kaia_syne7 Circadian clock protein KaiA see0009 kaiA Synpcc7942_1218 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MLSQIAICIWVESTAILQDCQRALSADRYQLQVCESGEMLLEYAQTHRDQIDCLILVAANPSFRAVVQQLCFEGVVVPAIVVGDRDSEDPDEPAKEQLYHSAELHLGIHQLEQLPYQVDAALAEFLRLAPVETMADHIMLMGANHDPELSSQQRDLAQRLQERLGYLGVYYKRDPDRFLRNLPAYESQKLHQAMQTSYREIVLSYFSPNSNLNQSIDNFVNMAFFADVPVTKVVEIHMELMDEFAKKLRVEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPRET kaib_syne7 Circadian clock protein KaiB kaiB see0010 Synpcc7942_1217 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MSPRKTYILKLYVAGNTPNSVRALKTLKNILEVEFQGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPLPVRRIIGDLSDREKVLIGLDLLYGELQDSDDF kaia-kaic-22 3212164 N/A 3212170 unspecified role unspecified role unspecified role unspecified role Q79PF4:p.[Ser431Glu;Thr432Glu] S431E/T432E mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q79PF4:p.[Ser431Ala;Thr432Ala] S431A/T432A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3212171 unspecified role unspecified role unspecified role unspecified role Fluorescein-label Fluorescein-label fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false kaia-3 3212165 N/A 3212171 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false kaic-4 3212166 N/A 3212170 unspecified role unspecified role unspecified role unspecified role Region 1-489 Region 1-489 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kaia-kaib-2 3212167 N/A 3212171 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3212172 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3212170 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false kaia-kaib-3 3212168 N/A 3212171 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3212172 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3212170 unspecified role unspecified role unspecified role unspecified role Q79PF4:p.Ser431Ala S431A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Region 1-489 Region 1-489 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false kaib-kaic-11 3212169 N/A 3212172 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3212170 unspecified role unspecified role unspecified role unspecified role Q79PF4:p.Ser431Ala S431A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q79PF4:p.[Ser431Ala;Thr432Ala] S431A/T432A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q79PF4:p.[Ser431Ala;Thr432Glu] S431A/T432E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q79PF4:p.[Ser431Asp;Thr432Ala] S431D/T432A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Region 1-489 Region 1-489 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false