DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ huseby-2010-1 in vitro In vitro comigration in sds comigration in sds page comigration in sds fingerprinting peptide massfingerprinting fingerprinting Huseby MJ., Kruse AC., Digre J., Kohler PL., Vocke JA., Mann EE., Bayles KW., Bohach GA., Schlievert PM., Ohlendorf DH., Earhart CA. DIP original experiment: DIP-219919X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Beta toxin catalyzes formation of nucleoprotein matrix in staphylococcal biofilms. Huseby MJ., Kruse AC., Digre J., Kohler PL., Vocke JA., Mann EE., Bayles KW., Bohach GA., Schlievert PM., Ohlendorf DH., Earhart CA. Only protein-protein interactions imex curation phlc_staau Phospholipase C hlb plc Beta-hemolysin Beta-toxin Sphingomyelinase protein protein staau Staphylococcus aureus MVKKTKSNSLKKVATLALANLLLVGALTDNSAKAESKKDDTDLKLVSHNVYMLSTVLYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPEFKDMLKNLNVNDVLYAGHNSTWDPQSNSIAKYNYPNGKPEHLDYIFTDKDHKQPKQLVNEVVTEKPKPWDVYAFPYYYVYNDFSDHYPIKAYSK hlb-1 3211829 N/A 3211830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false