DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ jeong-2010-1 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219895X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions imex curation jeong-2010-2 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219893X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions imex curation jeong-2010-3 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219899X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions imex curation jeong-2010-4 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219897X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions imex curation jeong-2010-5 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219896X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions imex curation jeong-2010-6 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219894X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions imex curation jeong-2010-7 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. DIP original experiment: DIP-219898X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cryptochrome 2 and phototropin 2 regulate resistance protein-mediated viral defense by negatively regulating an E3 ubiquitin ligase. Jeong RD., Chandra-Shekara AC., Barman SR., Navarre D., Klessig DF., Kachroo A., Kachroo P. Only protein-protein interactions imex curation bh063_arath Transcription factor bHLH63 BHLH63 EN84 Basic helix-loop-helix protein 63 Transcription factor EN 84 bHLH transcription factor bHLH063 T4L20.110 At4g34530 CIB1 Protein CRYPTOCHROME INTERACTING BASIC-HELIX-LOOP-HELIX 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNGAIGGDLLLNFPDMSVLERQRAHLKYLNPTFDSPLAGFFADSSMITGGEMDSYLSTAGLNLPMMYGETTVEGDSRLSISPETTLGTGNFKKRKFDTETKDCNEKKKKMTMNRDDLVEEGEEEKSKITEQNNGSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYIHVRARRGQATDSHSIAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEIINYVQSLQRQIEFLSMKLAIVNPRPDFDMDDIFAKEVASTPMTVVPSPEMVLSGYSHEMVHSGYSSEMVNSGYLHVNPMQQVNTSSDPLSCFNNGEAPSMWDSHVQNLYGNLGV cry2_arath Cryptochrome-2 Blue light photoreceptor CRY2 PHH1 Protein PHR homolog 1 Protein SUPPRESSOR OF elf3 20 SEL20 F19P19.14 At1g04400 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKMDKKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSLKALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIESVMLPPPWRLMPITAAAEAIWACSIEELGLENEAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVVGNSTSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYICFNFPFTHEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRVIVSSFAVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGSIPDGHELDRLDNPALQGAKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDIDTARELLAKAISRTREAQIMIGAAPDEIVADSFEALGANTIKEPGLCPSVSSNDQQVPSAVRYNGSKRVKPEEEEERDMKKSRGFDERELFSTAESSSSSSVFFVSQSCSLASEGKNLEGIQDSSDQITTSLGKNGCK rpp8_arath Disease resistance protein RPP8 RPP8 HRT Resistance to Peronospora parasitica protein 8 MWF20.19 At5g43470 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNKLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADDNYLSWQSKYCQMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSSVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEEWIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCDQ cop1_arath E3 ubiquitin-protein ligase COP1 COP1 Constitutive photomorphogenesis protein 1 RING-type E3 ubiquitin transferase COP1 T21L14.11 At2g32950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEISTDPVVPAVKPDPRTSSVGEGANRHENDDGGSGGSEIGAPDLDKDLLCPICMQIIKDAFLTACGHSFCYMCIITHLRNKSDCPCCSQHLTNNQLYPNFLLDKLLKKTSARHVSKTASPLDQFREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEVQTDLQYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDPSTRNAWPHEKNQIGFNSNSLSIRGGNFVGNYQNKKVEGKAQGSSHGLPKKDALSGSDSQSLNQSTVSMARKKRIHAQFNDLQECYLQKRRQLADQPNSKQENDKSVVRREGYSNGLADFQSVLTTFTRYSRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGSADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLAA morc1_arath Protein MICRORCHIDIA 1 MORC1 CRT1 Protein COMPROMISED RECOGNITION OF TCV 1 C7A10.1020 F23E13.180 At4g36290 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKNYTVADVVNIDSDSDSDDDNGGVIGMVPSLASLIENQKVSIADAATVAPRETLECRSFWKAGENFVIPSSVTLTAIGMVEHARVHPKFLHSNATSHKWAFGAIAELLDNAVDEIQNGATVVKIDKINIVKDNTPALVFQDNGGGMDPNGIRKCMSLGYSSKKSNTTIGQYGNGFKTSTMRLGADAMVFSRSTRGGKSTQSIGLLSYTFLRKTGQDDVIVPMIDFDISSDSPQPIIYGSPGDWSTNLNILLKWSPFSTMVELLQQFEDIGTHGTKVIIYNLWLNDEGIYELSFDDDDVDIRLRDENAQDGKRLHAKTLEVRSHISYRYRHSLRAYISMLYLKKFKNFKIILRGVSVAQFNIADEFRHPETIMYKPQAAAVDYAATGIKVGFIKEAPKLPICGFNVYHKNRLIRPFWKVVLEGSTRGNGVMGVLEANFIEPAHDKQDFERSSLFLRLEARLKRITSDYWQNHCHIFGYQTAQIPADKSKRTVIPDQPPTVNTYNPSPLPSDRISHGGPIIREINLSNATSSRTAAVAAPHLRNYTGLRNNFQPVQLNPQPPAAGDTGNNLVGKLAAEIREENLQLFMRCEEYVKKENEVEQTVKSLEKELEEIKSKCAQLALLVDAKKKEMQQV phot2_arath Phototropin-2 PHOT2 CAV1 KIN7 NPL1 Defective in chloroplast avoidance protein 1 Non-phototropic hypocotyl 1-like protein 1 K21L19.6 At5g58140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERPRAPPSPLNDAESLSERRSLEIFNPSSGKETHGSTSSSSKPPLDGNNKGSSSKWMEFQDSAKITERTAEWGLSAVKPDSGDDGISFKLSSEVERSKNMSRRSSEESTSSESGAFPRVSQELKTALSTLQQTFVVSDATQPHCPIVYASSGFFTMTGYSSKEIVGRNCRFLQGPDTDKNEVAKIRDCVKNGKSYCGRLLNYKKDGTPFWNLLTVTPIKDDQGNTIKFIGMQVEVSKYTEGVNDKALRPNGLSKSLIRYDARQKEKALDSITEVVQTIRHRKSQVQESVSNDTMVKPDSSTTPTPGRQTRQSDEASKSFRTPGRVSTPTGSKLKSSNNRHEDLLRMEPEELMLSTEVIGQRDSWDLSDRERDIRQGIDLATTLERIEKNFVISDPRLPDNPIIFASDSFLELTEYSREEILGRNCRFLQGPETDQATVQKIRDAIRDQREITVQLINYTKSGKKFWNLFHLQPMRDQKGELQYFIGVQLDGSDHVEPLQNRLSERTEMQSSKLVKATATNVDEAVRELPDANTRPEDLWAAHSKPVYPLPHNKESTSWKAIKKIQASGETVGLHHFKPIKPLGSGDTGSVHLVELKGTGELYAMKAMEKTMMLNRNKAHRACIEREIISLLDHPFLPTLYASFQTSTHVCLITDFCPGGELFALLDRQPMKILTEDSARFYAAEVVIGLEYLHCLGIVYRDLKPENILLKKDGHIVLADFDLSFMTTCTPQLIIPAAPSKRRRSKSQPLPTFVAEPSTQSNSFVGTEEYIAPEIITGAGHTSAIDWWALGILLYEMLYGRTPFRGKNRQKTFANILHKDLTFPSSIPVSLVGRQLINTLLNRDPSSRLGSKGGANEIKQHAFFRGINWPLIRGMSPPPLDAPLSIIEKDPNAKDIKWEDDGVLVNSTDLDIDLF bhlh63-cry2-1 3211357 N/A 3211364 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana N/A 3211365 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana direct interaction direct interaction false false false cop1-rpp8-1 3211358 N/A 3211366 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3211367 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana physical association physical association false false false morc1-rpp8-1 3211359 N/A 3211368 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana N/A 3211366 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana direct interaction direct interaction false false false cop1-rpp8-2 3211360 N/A 3211366 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana N/A 3211367 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana direct interaction direct interaction false false false cop1-cry2-1 3211361 N/A 3211367 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana N/A 3211365 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana direct interaction direct interaction false false false cop1-phot2-1 3211362 N/A 3211369 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3211367 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana physical association physical association false false false cop1-phot2-2 3211363 N/A 3211369 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana N/A 3211367 unspecified role unspecified role unspecified role unspecified role Unkown fragment of YFP YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana direct interaction direct interaction false false false