DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cuello-2010-2 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219449X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219443X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-4 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219446X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-5 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219452X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-6 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219444X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-7 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219450X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-8 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219453X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-9 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219454X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-10 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219447X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-11 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219445X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-12 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219448X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation cuello-2010-13 in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. DIP original experiment: DIP-219451X Nature 2010 IMEx Structural basis for the coupling between activation and inactivation gates in K(+) channels. Cuello LG., Jogini V., Cortes DM., Pan AC., Gagnon DG., Dalmas O., Cordero-Morales JF., Chakrapani S., Roux B., Perozo E. Only protein-protein interactions imex curation kcsa_strli pH-gated potassium channel KcsA Streptomyces lividans K+ channel kcsA skc1 protein protein strli Streptomyces lividans MPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR mint kcsa-13 3211035 N/A 3211047 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-14 3211036 N/A 3211047 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false kcsa-15 3211037 N/A 3211047 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-16 3211038 N/A 3211047 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-17 3211039 N/A 3211047 unspecified role unspecified role unspecified role unspecified role Region 1-124 Region 1-124 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-18 3211040 N/A 3211047 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-19 3211041 N/A 3211047 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-20 3211042 N/A 3211047 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-21 3211043 N/A 3211047 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-22 3211044 N/A 3211047 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Alexa488-label Alexa488-label alexa 488 label alexa 488 label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3211047 unspecified role unspecified role fluorescence donor fluorescence donor Alexa350-label Alexa350-label alexa 350 label alexa 350 label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-23 3211045 N/A 3211047 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcsa-24 3211046 N/A 3211047 unspecified role unspecified role unspecified role unspecified role MTS-label MTS-label spin label spin label certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false