DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zeng-2010-2 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. DIP original experiment: DIP-219435X Nature 2010 IMEx Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b. Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. Only protein-protein interactions imex curation zeng-2010-3 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. DIP original experiment: DIP-219433X Nature 2010 IMEx Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b. Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. Only protein-protein interactions imex curation zeng-2010-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. DIP original experiment: DIP-219437X Nature 2010 IMEx Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b. Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. Only protein-protein interactions imex curation zeng-2010-5 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. DIP original experiment: DIP-219441X Nature 2010 IMEx Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b. Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. Only protein-protein interactions imex curation zeng-2010-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. DIP original experiment: DIP-219439X Nature 2010 IMEx Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b. Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. Only protein-protein interactions imex curation zeng-2010-7 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. DIP original experiment: DIP-219434X Nature 2010 IMEx Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b. Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. Only protein-protein interactions imex curation zeng-2010-8 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. DIP original experiment: DIP-219438X Nature 2010 IMEx Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b. Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. Only protein-protein interactions imex curation zeng-2010-9 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. DIP original experiment: DIP-219436X Nature 2010 IMEx Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b. Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. Only protein-protein interactions imex curation zeng-2010-10 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. DIP original experiment: DIP-219442X Nature 2010 IMEx Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b. Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. Only protein-protein interactions imex curation zeng-2010-11 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. DIP original experiment: DIP-219440X Nature 2010 IMEx Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b. Zeng L., Zhang Q., Li S., Plotnikov AN., Walsh MJ., Zhou MM. Only protein-protein interactions imex curation h3tail H3 tail peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ARTKQTARKSTGGKAPRKQL q92784-1 Zinc finger protein DPF3 DPF3 BAF45C CERD4 BRG1-associated factor 45C Zinc finger protein cer-d4 DPF3b protein protein human Homo sapiens Human MATVIHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCYIWMEKRHRGPGLAPGQLYTYPARCWRKKRRLHPPEDPKLRLLEIKPEVELPLKKDGFTSESTTLEALLRGEGVEKKVDAREEESIQEIQRVLENDENVEEGNEEEDLEEDIPKRKNRTRGRARGSAGGRRRHDAASQEDHDKPYVCDICGKRYKNRPGLSYHYAHTHLASEEGDEAQDQETRSPPNHRNENHRPQKGPDGTVIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKASAFGCQA h4-2 Histone 4 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SGRGKGGKGLGKGGAKRHRKVLR cbx5_mouse Chromobox protein homolog 5 Cbx5 Hp1a Heterochromatin protein 1 homolog alpha protein protein mouse Mus musculus Mouse MGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSEGNKRKSSFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKESAKS a2a654_mouse Bptf protein protein mouse Mus musculus Mouse MRGRRGRPPKQPAAPAAERCAPAPPPPPPPPPPPPPPPPPPPPASGPIGGLRSRHRGSSRGRWAAAQAEVAPKTRLSSPRGGGRRKQPPPPPPASGSSASGPGRGGRGGGGGRTGGGGGHLARTTPARRAVNKVVYDDHESDDDDEEEDMVSEEDEEEEEDGDAEETQDSEDEEEDDMEEDDDDSDYPEEMEDDDDDASYCTESSFRSHSTYSSTPGRRKPRVHRPRSPILEEKDIPPLEFPKSSEDLMVPNEHIMNVIAIYEVVRNFGNVLRLSPFCFEDFCAALVSQEQCTLMAEMHVALLKAVLREEDTSNTTFGPADLKDSVNSTLYFIDGMTWPEVLRVYCESDKEYHHVLPYQEAEDYPYGPVENKIKVLQFLVDQFLTTNIAREELMSEGVIQYDDHCRVCHKLGDLLCCETCSAVYHLECVKPPLEEVPEDEWQCEVCVAHKVPGVTDCVAEVQKNKPYVRHEPIGYDRSRRKYWFLNRRLIIEEDTDNENEKKVWYYSTKVQLAELIDCLDKGYWEAELCRVLEDIREEMQQHMDVTEDLTNKARGSNKSFLAAANEEILDSLRIKRGEDIDCDQSPEDPEKDKHEGENNSSKDAEKSREEAEDPSADKDADSKGLEEEPGHGKPEEPTEVGDKGNSVPANLGDNTTNASPEETSPCDGRSPEGCLSETHDSSSMAEKKVASELPPDVPEDSNRTCDSSNTSATTASSQPNLETCSSSELTSSQSDSAKAADDPEIGERDSHTPVSVHEEIGDFRLEKSNGEVSESPGAGKGTSGSTRIITRLRNPESKLSQLKSQQVAAAAHEANKLFKEGKEVLVVNSQGEVSRLSTKKEVVMKGNINNYFKLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVHGSKVLTISTLRLTITQLESNIPSSFLHPNWASHRANWIKAVQMCSKPREFALALAILECAVKPVVMLPIWRESLGHTRLHRMTSIEREEKEKVKKKEKKQEEEETMQQATWVKYTFPVKHQVTGYGGWSWISKTHVYRFLPKLPGNTNVNYRKPLDGAKNNTDENKDESEKRKSPRSPKKMKTECDSEQGETRDADATAGAAAGAMELSKEPEKKDQDVKELLDSDNDKSFKEEPMEIDDTIKTESHVSSLESTEVDVVNVSEGFHLRTSYKKKTKSSKLDGLLERRIRQFTLEEKQRLEKLKLESGVKGAGKPPMGALKSSSESPGSTKASEGHQGDSLRQEQSPSSSQASTVDLGLGGSQSDPLVLGISPPSLSTHKPDPKDQVLDDVSIQSPGPNCQRQNSVESDLDARISEPAGKGLELSQTKTEVTDSSSDDSKPTSADDVGILICKSRKLHSQDDSSTVVSSSKSTLPASVPKSPRDRDARAFSKAVDFDGRLGGDSEYSSTLENSSDNMCIRDSAEEDMVVQNSSEATSKRFIAPEQGGESVESTKCQVVSKSTENCEDKLQGKVTEANGKKLGQHPPKPEERAVNRCTDQVSLRHSVDRKNSEPRESEKKGQKANKFQINGKDSKAKGYLKGPGTKDGSDGKVVSSAVEPKVNNINKVIPGNTKSLAGKESAAKPFINGDIIMEELSEQNTSETNSYSLSSSDAKGNHQDGLHTLPSTKESASTQVITPRAPCPDRNSLSQVEDMETESPEVKRVIPSPVRTGEGSNLSKGFMDDNGLPSSKDENVNGESQRKTVITEVTTMTSTVATESKTVIKVAKGDKQTVVSSTENCARSTVTTTTTTVTKLSTPSPDTGVDTISVKEQSKTVVTTTVTDSLTTAGSTLVTSMTVSKEYSTRDRVKLMKFSRPKKTRSGTALPSYRKFVTKSSKKSIFVLPNDDLKKLARKGGIREVPYFNYNAKPALDIWPYPSPRPTFGITWRYRLQTVKSLAGVSLMLRLLWASLRWDDMAAKAPPGGGSTRTETSETEITTTEIIKRRDVGPYGIRSEYCIRKIICPIGVPEAPKETPTPQRKGLRSSALRPKRPETPKQTGPVIIESWVAEEELELWEIRAFAERVEKEKAQAAEQQTKKRLEQQKPAVIAASTTSPANNTSSTVSPAQKVMVAPLSGSVTPGTKMVLATKVGSPATVTFQQNKNFHQTFATWVKQGQSNSGMVQVQQKVLGIIPSTTGPSQQTFTSFQPRTATVTIRPNTSASAGTTTTSQVITGPQIRPGMTVIRTPLQQPALGKAIIRTPVVVQPGTPQQVVTQIIRGQPVSTAISAPSTASSAPVQKGLTPGAAAGPLQPSAPHSPRPQQGQVKLTMAQLTQLTQGHGGNQGLTVVIQGQGQTTGQLQLIPQGMTVLPGPGQQLMQAAMPNGTVQRFLFTPLSTSATAASSSSNSSSTTTNATAAGSGEQKQSKILPQTQVQPATTLAPTQSSSVSPAEAQPQPAQPAAQPQPQPQPPAQPEVQTQPAVSSHVPSETQPSQAQTSKPLVATQCQPQSSVQGQSPVRVQSPPLTRIRPSTPSQVTPGQQPQVQTTASQPIPIPPPTSLQAPSQGQPQSQPQVQSSTQTLSSGQTLNQVTVLSPSCPQPQPQVIAVPQLQQVQVLSQIQSQVVAQIQAQQSGVPQQIKLQLPIQVQQNSAAQTQSVVTVQAASVQEQLQRVQQLRDQQQKKKQQIETEREHTLQASNQSEIIQKQVVMKHNAVIEHLKQKKTMTPAEREENQRMIVCNQVMKYILDKIDKEEKQAAKKRKREESVEQKRSKQNASKLSALLFKHKEQLKAEILRKRALLDKELQIQVQEELKRDLKMKREREMAQAVQANAASVPTPSVPAPVPAPAPAAPPAPPRSPPPSTHSLPPAGHPTAPLPVTSQKRKREEEKDSKSKKKKMISTTSKEAKKDTRLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEADLIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERIQKRYYEKLTEFVADMTKIFDNCRYYNPRDTPFYQCAEVLESFFVQKLKGFKASRSHNNKLQSTAP DB5E7A095A97E3AA requ_mouse Zinc finger protein ubi-d4 Dpf2 Baf45d Req Ubid4 Apoptosis response zinc finger protein BRG1-associated factor 45D D4, zinc and double PHD fingers family 2 Protein requiem protein protein mouse Mus musculus Mouse MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVSNSRARKRIIEPDDFLDDLDDEDYEEDTPKRRGKGKSKSKGVSSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSRPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNLCGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS dpf3-h3-1 3210962 N/A 3210972 unspecified role unspecified role unspecified role unspecified role Region 1-18 Region 1-18 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false FITC-label FITC-label fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false in vitro In vitro N/A 3210973 unspecified role unspecified role unspecified role unspecified role PHD1-2 domain Region 261-372 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dpf3-h3-2 3210963 N/A 3210972 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3210973 unspecified role unspecified role unspecified role unspecified role PHD1-2 domain Region 261-372 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dpf3-h4-1 3210964 N/A 3210974 unspecified role unspecified role unspecified role unspecified role Region 1-22 Region 1-22 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3210973 unspecified role unspecified role unspecified role unspecified role PHD1-2 domain Region 261-372 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false h3-cbx5-1 3210965 N/A 3210975 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3210972 unspecified role unspecified role bait bait Region 1-18 Region 1-18 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false K9me3 K9me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false h3-dpf3-1 3210966 N/A 3210972 unspecified role unspecified role bait bait Region 1-18 Region 1-18 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false in vitro In vitro N/A 3210973 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse physical association physical association false false false dpf3-h4-2 3210967 N/A 3210974 unspecified role unspecified role unspecified role unspecified role Region 1-22 Region 1-22 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Region 9-23 Region 9-23 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3210973 unspecified role unspecified role unspecified role unspecified role PHD1-2 domain Region 261-372 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dpf3-h3-3 3210968 N/A 3210972 unspecified role unspecified role unspecified role unspecified role Region 1-18 Region 1-18 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3210973 unspecified role unspecified role unspecified role unspecified role PHD1-2 domain Region 261-372 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q92784-1:p.Asp335Ala D335A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q92784-1:p.Glu315Ala E315A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dpf3-h4-3 3210969 N/A 3210974 unspecified role unspecified role unspecified role unspecified role Region 12-23 Region 12-23 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false FITC-label FITC-label fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal false in vitro In vitro N/A 3210973 unspecified role unspecified role unspecified role unspecified role PHD1-2 domain Region 261-372 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false h3-bptf-1 3210970 N/A 3210976 unspecified role unspecified role prey prey K4me3 K4me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain false mouse Mus musculus Mouse N/A 3210972 unspecified role unspecified role bait bait Region 1-18 Region 1-18 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false in vitro In vitro physical association physical association false false false h3-dpf2-1 3210971 N/A 3210977 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3210972 unspecified role unspecified role bait bait Region 1-18 Region 1-18 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false in vitro In vitro physical association physical association false false false