DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hang-2010-1 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219455X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation hang-2010-2 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219456X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation hang-2010-3 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219461X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation hang-2010-4 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219465X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation hang-2010-5 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219467X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation hang-2010-6 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219457X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation hang-2010-7 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219462X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation hang-2010-8 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219466X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation hang-2010-9 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219468X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation hang-2010-10 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219458X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation hang-2010-11 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219463X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation hang-2010-12 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219459X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation hang-2010-13 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219464X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation hang-2010-14 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. DIP original experiment: DIP-219460X Nature 2010 IMEx Chromatin regulation by Brg1 underlies heart muscle development and disease. Hang CT., Yang J., Han P., Cheng HL., Shang C., Ashley E., Zhou B., Chang CP. Only protein-protein interactions imex curation smca4_mouse Transcription activator BRG1 Smarca4 Baf190a Brg1 Snf2b Snf2l4 ATP-dependent helicase SMARCA4 BRG1-associated factor 190A Protein brahma homolog 1 SNF2-beta SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 protein protein mouse Mus musculus Mouse MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPMPTQGPGGYPQDNMHQMHKPMESMHEKGMPDDPRYNQMKGMGMRSGAHTGMAPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGSDPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPLVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA parp1_mouse Poly [ADP-ribose] polymerase 1 Poly[ADP-ribose] synthase 1 NAD(+) ADP-ribosyltransferase 1 Parp1 Adprp Adprt Adprt1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein mouse Mus musculus Mouse MAEASERLYRVQYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGQSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGSGGKAEKTLGDFAAEYAKSNRSMCKGCLEKIEKGQMRLSKKMVDPEKPQLGMIDRWYHPTCFVKKRDELGFRPEYSASQLKGFSLLSAEDKEALKKQLPAIKNEGKRKGDEVDGTDEVAKKKSRKETDKYSKLEKALKAQNELIWNIKDELKKACSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCKECSGQLVFKSDAYYCTGDVTAWTKCMVKTQNPSRKEWVTPKEFREISYLKKLKVKKQDRIFPPESSAPITVHWPLSVTSAPTAVNSSAPADKPLSNMKILTLGKLSQNKDEAKAVIEKLGGKLTGSANKASLCISIKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQDLLSAHSLSPWGAEVKAEPGEVVAPRGKSAAPSKKSKGCFKEEGVNKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRLGTVIGSNKLEQMPSKEEAVEQFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVKPGTKSKLPKPVQELVGMIFDVDSMKKALVEYEIDLQKMPLGKLSRRQIQAAYSILSEVQQPVSQGSSESQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIMLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITLEGVEVPLGTGIPSGVNDTALLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW hdac2_mouse Histone deacetylase 2 Hdac2 Yy1bp YY1 transcription factor-binding protein protein protein mouse Mus musculus Mouse MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVAKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDPKGAKSEQLSNP hdac9_mouse Histone deacetylase 9 Histone deacetylase 7B Histone deacetylase-related protein MEF2-interacting transcription repressor MITR Hdac9 Hdac7b Hdrp Mitr protein protein mouse Mus musculus Mouse MHSMISSVDVKSEVPMGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTNGKNHSVGRHPKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDSKDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGNLVTSFKKRVFEVAESSVSSSSPGSGPSSPNNGPAGNVTENEASALPPTPHPEQLVPQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSPLNASNSLKDKQKCETQMLRQGVPLPSQYGSSIAASSSHVHVAMEGKPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQSMEDRAASKDNSARSDSSACVEDTLGQVGAVKVKEEPVDSDEDAQIQEMECGEQAAFMQQVIGKDLAPGFVIKVII hdac3_mouse Histone deacetylase 3 Hdac3 protein protein mouse Mus musculus Mouse MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVISQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKES hdac1-smarca4-1 3210681 N/A 3210695 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3210696 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false smarca4-hdac1-1 3210682 N/A 3210695 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3210696 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false smarca4-hdac2-1 3210683 N/A 3210697 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3210698 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3210699 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3210695 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association false false false hdac2-parp1-1 3210684 N/A 3210697 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3210698 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false hdac3-smarca4-1 3210685 N/A 3210700 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3210695 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false hdac2-smarca4-1 3210686 N/A 3210698 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3210695 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false hdac2-parp1-2 3210687 N/A 3210697 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3210698 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3210695 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false parp1-hdac2-1 3210688 N/A 3210697 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3210698 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false smarca4-hdac3-1 3210689 N/A 3210700 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3210695 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false smarca4-hdac2-2 3210690 N/A 3210698 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3210695 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false smarca4-parp1-1 3210691 N/A 3210697 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3210695 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false hdac9-smarca4-1 3210692 N/A 3210699 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3210695 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false parp1-hdac9-1 3210693 N/A 3210697 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3210699 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false smarca4-hdac9-1 3210694 N/A 3210699 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3210695 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false