DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ merdanovic-2010-1 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218334X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions imex curation merdanovic-2010-2 in vitro In vitro crosslink cross-linking study crosslink weight silver stain molecular weight estimation by silver staining weight silver stain Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218330X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions imex curation merdanovic-2010-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218331X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions imex curation merdanovic-2010-4 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218337X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions imex curation merdanovic-2010-5 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218335X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions imex curation merdanovic-2010-6 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218332X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions imex curation merdanovic-2010-7 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218333X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions imex curation merdanovic-2010-8 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. DIP original experiment: DIP-218336X Nature structural & molecular biology 2010 IMEx Determinants of structural and functional plasticity of a widely conserved protease chaperone complex. Merdanovic M., Mamant N., Meltzer M., Poepsel S., Auckenthaler A., Melgaard R., Hauske P., Nagel-Steger L., Clarke AR., Kaiser M., Huber R., Ehrmann M. Only protein-protein interactions imex curation casb_bovin Beta-casein CSN2 protein protein bovin Bos taurus (Bovine) Bovine MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV degp_ecoli Periplasmic serine endoprotease DegP degP htrA ptd b0161 JW0157 Heat shock protein DegP Protease Do protein protein ecoli Escherichia coli (strain K12) MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ dnrdgnvyff Activator peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) DNRDGNVYFF dpmfklv Activator peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) DPMFKLV csn2-degp-6 3210630 N/A 3210638 enzyme target enzyme target substrate substrate unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3210639 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage false false false degp-11 3210631 N/A 3210639 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degp-dnrdgnvyff-1 3210632 N/A 3210640 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3210639 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degp-dpmfklv-1 3210633 N/A 3210641 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3210639 unspecified role unspecified role unspecified role unspecified role P0C0V0:p.Phe266Ala F266A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.[Arg288Ala;Val354Ser] R288A/V354S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.Glu222Ala E222A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.Phe224Ala F224A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false degp-dnrdgnvyff-2 3210634 N/A 3210640 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3210639 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degp-dpmfklv-2 3210635 N/A 3210641 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3210639 unspecified role unspecified role unspecified role unspecified role P0C0V0:p.Arg288Ala R288A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.Val354Ser V354S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.[Arg288Ala;Val354Ser] R288A/V354S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.Leu291Asn L291N mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.Leu350Asn L350N mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.Arg213Ala R213A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.Leu216Ala L216A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.Glu222Ala E222A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.Phe224Ala F224A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.Leu255Ala L255A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.Ile264Ala I264A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.Phe266Ala F266A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false csn2-degp-7 3210636 N/A 3210638 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3210639 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false csn2-degp-8 3210637 N/A 3210638 enzyme target enzyme target substrate substrate unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3210639 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false