DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ krojer-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Krojer T., Sawa J., Huber R., Clausen T. DIP original experiment: DIP-218324X Nature structural & molecular biology 2010 IMEx HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. Krojer T., Sawa J., Huber R., Clausen T. Only protein-protein interactions imex curation krojer-2010-2 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Krojer T., Sawa J., Huber R., Clausen T. DIP original experiment: DIP-218327X Nature structural & molecular biology 2010 IMEx HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. Krojer T., Sawa J., Huber R., Clausen T. Only protein-protein interactions imex curation krojer-2010-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Krojer T., Sawa J., Huber R., Clausen T. DIP original experiment: DIP-218325X Nature structural & molecular biology 2010 IMEx HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. Krojer T., Sawa J., Huber R., Clausen T. Only protein-protein interactions imex curation krojer-2010-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Krojer T., Sawa J., Huber R., Clausen T. DIP original experiment: DIP-218328X Nature structural & molecular biology 2010 IMEx HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. Krojer T., Sawa J., Huber R., Clausen T. Only protein-protein interactions imex curation krojer-2010-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Krojer T., Sawa J., Huber R., Clausen T. DIP original experiment: DIP-218326X Nature structural & molecular biology 2010 IMEx HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. Krojer T., Sawa J., Huber R., Clausen T. Only protein-protein interactions imex curation krojer-2010-6 in vitro In vitro protease assay protease assay weight by comassie molecular weight estimation by coomasie staining weight by comassie Krojer T., Sawa J., Huber R., Clausen T. DIP original experiment: DIP-218329X Nature structural & molecular biology 2010 IMEx HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. Krojer T., Sawa J., Huber R., Clausen T. Only protein-protein interactions imex curation degp_ecoli Periplasmic serine endoprotease DegP degP htrA ptd b0161 JW0157 Heat shock protein DegP Protease Do protein protein ecoli Escherichia coli (strain K12) MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ yqv YQV peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SPMFKGVLDMMYGGMRGYQV casb_bovin Beta-casein CSN2 protein protein bovin Bos taurus (Bovine) Bovine MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV degp-9 3210598 N/A 3210604 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false degp-yqv-1 3210599 N/A 3210605 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3210604 unspecified role unspecified role unspecified role unspecified role P0C0V0:p.Leu291Trp L291W mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false degp-10 3210600 N/A 3210604 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false csn2-degp-4 3210601 N/A 3210606 unspecified role unspecified role unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3210604 unspecified role unspecified role unspecified role unspecified role P0C0V0:p.Leu291Trp L291W mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.[Arg351Ala;Gln353Ala] R351A/Q353A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false degp-yqv-2 3210602 N/A 3210605 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3210604 unspecified role unspecified role unspecified role unspecified role P0C0V0:p.Leu291Trp L291W mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false csn2-degp-5 3210603 N/A 3210606 enzyme target enzyme target substrate substrate unspecified role unspecified role bovin Bos taurus (Bovine) Bovine N/A 3210604 enzyme enzyme unspecified role unspecified role P0C0V0:p.Leu291Trp L291W mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.Arg213Ala R213A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P0C0V0:p.[Arg351Ala;Gln353Ala] R351A/Q353A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli protein cleavage protein cleavage false false false