DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wong-2010-8 in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Wong YL., Rice SE. DIP original experiment: DIP-219869X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Kinesin's light chains inhibit the head- and microtubule-binding activity of its tail. Wong YL., Rice SE. Only protein-protein interactions imex curation wong-2010-9 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by staining molecular weight estimation by staining weight by staining Wong YL., Rice SE. DIP original experiment: DIP-219873X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Kinesin's light chains inhibit the head- and microtubule-binding activity of its tail. Wong YL., Rice SE. Only protein-protein interactions imex curation wong-2010-10 in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Wong YL., Rice SE. DIP original experiment: DIP-219871X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Kinesin's light chains inhibit the head- and microtubule-binding activity of its tail. Wong YL., Rice SE. Only protein-protein interactions imex curation wong-2010-11 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Wong YL., Rice SE. DIP original experiment: DIP-219874X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Kinesin's light chains inhibit the head- and microtubule-binding activity of its tail. Wong YL., Rice SE. Only protein-protein interactions imex curation wong-2010-12 in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Wong YL., Rice SE. DIP original experiment: DIP-219870X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Kinesin's light chains inhibit the head- and microtubule-binding activity of its tail. Wong YL., Rice SE. Only protein-protein interactions imex curation wong-2010-13 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by staining molecular weight estimation by staining weight by staining Wong YL., Rice SE. DIP original experiment: DIP-219872X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Kinesin's light chains inhibit the head- and microtubule-binding activity of its tail. Wong YL., Rice SE. Only protein-protein interactions imex curation klc_drome Kinesin light chain Klc CG5433 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNEKSDMLRKNIENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREEHKFDNRENTPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTKLSQLLTSNEKRRSKAIKEDLDFSEEKNAKP kinh_drome Kinesin heavy chain Khc kin CG7765 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSAEREIPAEDSIKVVCRFRPLNDSEEKAGSKFVVKFPNNVEENCISIAGKVYLFDKVFKPNASQEKVYNEAAKSIVTDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDSVKQGIIPRIVNDIFNHIYAMEVNLEFHIKVSYYEIYMDKIRDLLDVSKVNLSVHEDKNRVPYVKGATERFVSSPEDVFEVIEEGKSNRHIAVTNMNEHSSRSHSVFLINVKQENLENQKKLSGKLYLVDLAGSEKVSKTGAEGTVLDEAKNINKSLSALGNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIVICCSPASFNESETKSTLDFGRRAKTVKNVVCVNEELTAEEWKRRYEKEKEKNARLKGKVEKLEIELARWRAGETVKAEEQINMEDLMEASTPNLEVEAAQTAAAEAALAAQRTALANMSASVAVNEQARLATECERLYQQLDDKDEEINQQSQYAEQLKEQVMEQEELIANARREYETLQSEMARIQQENESAKEEVKEVLQALEELAVNYDQKSQEIDNKNKDIDALNEELQQKQSVFNAASTELQQLKDMSSHQKKRITEMLTNLLRDLGEVGQAIAPGESSIDLKMSALAGTDASKVEEDFTMARLFISKMKTEAKNIAQRCSNMETQQADSNKKISEYEKDLGEYRLLISQHEARMKSLQESMREAENKKRTLEEQIDSLREECAKLKAAEHVSAVNAEEKQRAEELRSMFDSQMDELREAHTRQVSELRDEIAAKQHEMDEMKDVHQKLLLAHQQMTADYEKVRQEDAEKSSELQNIILTNERREQARKDLKGLEDTVAKELQTLHNLRKLFVQDLQQRIRKNVVNEESEEDGGSLAQKQKISFLENNLDQLTKVHKQLVRDNADLRCELPKLEKRLRCTMERVKALETALKEAKEGAMRDRKRYQYEVDRIKEAVRQKHLGRRGPQAQIAKPIRSGQGAIAIRGGGAVGGPSPLAQVNPVNS fez1_human Fasciculation and elongation protein zeta-1 FEZ1 Zygin-1 Zygin I protein protein human Homo sapiens Human MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKSENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVQQLARRDELEFEKEVKNSFITVLIEVQNKQKEQRELMKKRRKEKGLSLQSSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEKKASPPSVEDLQMLTNILFAMKEDNEKVPTLLTDYILKVLCPT khc-klc-1 3210410 N/A 3210416 unspecified role unspecified role prey prey Coiled-coil domain Region 1-148 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3210417 unspecified role unspecified role bait bait Region 790-975 Region 790-975 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false khc-klc-2 3210411 N/A 3210416 unspecified role unspecified role unspecified role unspecified role Region 1-179 Region 1-179 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3210417 unspecified role unspecified role unspecified role unspecified role Region 790-975 Region 790-975 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false khc-fez1-1 3210412 N/A 3210418 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3210417 unspecified role unspecified role bait bait Region 790-975 Region 790-975 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false khc-khc-1 3210413 N/A 3210417 unspecified role unspecified role unspecified role unspecified role Region 1-401 Region 1-401 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Fluorescein-label Fluorescein-label fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3210417 unspecified role unspecified role unspecified role unspecified role Region 790-975 Region 790-975 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false khc-fez1-2 3210414 N/A 3210418 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3210416 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3210417 unspecified role unspecified role bait bait Region 790-975 Region 790-975 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false fez1-khc-1 3210415 N/A 3210418 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3210417 unspecified role unspecified role unspecified role unspecified role Region 790-975 Region 790-975 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false