DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ korkhov-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Korkhov VM., Sachse C., Short JM., Tate CG. DIP original experiment: DIP-216928X Structure (London, England : 1993) 2010 IMEx Three-dimensional structure of TspO by electron cryomicroscopy of helical crystals. Korkhov VM., Sachse C., Short JM., Tate CG. Only protein-protein interactions imex curation korkhov-2010-2 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Korkhov VM., Sachse C., Short JM., Tate CG. DIP original experiment: DIP-216929X Structure (London, England : 1993) 2010 IMEx Three-dimensional structure of TspO by electron cryomicroscopy of helical crystals. Korkhov VM., Sachse C., Short JM., Tate CG. Only protein-protein interactions imex curation korkhov-2010-3 ecolx Escherichia coli bn-page blue native page bn-page weight by comassie molecular weight estimation by coomasie staining weight by comassie Korkhov VM., Sachse C., Short JM., Tate CG. DIP original experiment: DIP-216930X Structure (London, England : 1993) 2010 IMEx Three-dimensional structure of TspO by electron cryomicroscopy of helical crystals. Korkhov VM., Sachse C., Short JM., Tate CG. Only protein-protein interactions imex curation korkhov-2010-4 ecolx Escherichia coli bn-page blue native page bn-page weight by comassie molecular weight estimation by coomasie staining weight by comassie Korkhov VM., Sachse C., Short JM., Tate CG. DIP original experiment: DIP-216931X Structure (London, England : 1993) 2010 IMEx Three-dimensional structure of TspO by electron cryomicroscopy of helical crystals. Korkhov VM., Sachse C., Short JM., Tate CG. Only protein-protein interactions imex curation tspo_cersp Tryptophan-rich sensory protein tspO crtK Translocator protein TspO TspO regulatory protein protein protein rhosh Rhodobacter sphaeroides Rhodopseudomonas sphaeroides MNMDWALFLTFLAACGAPATTGALLKPDEWYDNLNKPWWNPPRWVFPLAWTSLYFLMSLAAMRVAQLEGSGQALAFYAAQLAFNTLWTPVFFGMKRMATALAVVMVMWLFVAATMWAFFQLDTWAGVLFVPYLIWATAATGLNFEAMRLNWNRPEARA emre_ecoli Multidrug transporter EmrE emrE eb mvrC Efflux-multidrug resistance protein EmrE Ethidium resistance protein Methyl viologen resistance protein C b0543 JW0531 protein protein ecoli Escherichia coli (strain K12) MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLSRSTPH tspo-1 3210166 N/A 3210170 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tspo-2 3210167 N/A 3210170 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tspo-3 3210168 N/A 3210170 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false emre-2 3210169 N/A 3210171 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false