DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ren-2010-3 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Ren Y., Seo HS., Blobel G., Hoelz A. DIP original experiment: DIP-219815X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Ren Y., Seo HS., Blobel G., Hoelz A. Only protein-protein interactions imex curation ren-2010-4 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ren Y., Seo HS., Blobel G., Hoelz A. DIP original experiment: DIP-219817X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Ren Y., Seo HS., Blobel G., Hoelz A. Only protein-protein interactions imex curation ren-2010-5 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Ren Y., Seo HS., Blobel G., Hoelz A. DIP original experiment: DIP-219818X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Ren Y., Seo HS., Blobel G., Hoelz A. Only protein-protein interactions imex curation ren-2010-6 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ren Y., Seo HS., Blobel G., Hoelz A. DIP original experiment: DIP-219816X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Ren Y., Seo HS., Blobel G., Hoelz A. Only protein-protein interactions imex curation ren-2010-7 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ren Y., Seo HS., Blobel G., Hoelz A. DIP original experiment: DIP-219819X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1. Ren Y., Seo HS., Blobel G., Hoelz A. Only protein-protein interactions imex curation rae1l_human mRNA export factor mRNA-associated protein mrnp 41 Rae1 protein homolog RAE1 MRNP41 protein protein human Homo sapiens Human MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK nup98_human Nuclear pore complex protein Nup98-Nup96 NUP98 ADAR2 protein protein human Homo sapiens Human MFNKSFGTPFGGGTGGFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPGGLFGTSSFSQPATSTSTGFGFGTSTGTANTLFGTASTGTSLFSSQNNAFAQNKPTGFGNFGTSTSSGGLFGTTNTTSNPFGSTSGSLFGPSSFTAAPTGTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGFAYGQNKTAFGTSTTGFGTNPGGLFGQQNQQTTSLFSKPFGQATTTQNTGFSFGNTSTIGQPSTNTMGLFGVTQASQPGGLFGTATNTSTGTAFGTGTGLFGQTNTGFGAVGSTLFGNNKLTTFGSSTTSAPSFGTTSGGLFGNKPTLTLGTNTNTSNFGFGTNTSGNSIFGSKPAPGTLGTGLGAGFGTALGAGQASLFGNNQPKIGGPLGTGAFGAPGFNTTTATLGFGAPQAPVALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKADTSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEKLSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL rae1-nup98-2 3209294 N/A 3209299 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3209300 unspecified role unspecified role prey prey GLEBS motif domain Region 157-213 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false nup98-rae1-1 3209295 N/A 3209299 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3209300 unspecified role unspecified role unspecified role unspecified role GLEBS motif domain Region 157-213 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false nup98-rae1-2 3209296 N/A 3209299 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3209300 unspecified role unspecified role unspecified role unspecified role GLEBS motif domain Region 157-213 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false nup98-rae1-3 3209297 N/A 3209299 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3209300 unspecified role unspecified role unspecified role unspecified role GLEBS motif domain Region 157-213 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false nup98-rae1-4 3209298 N/A 3209299 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3209300 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P52948:p.[Glu201Lys;Glu202Lys] E201K/E202K mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Region 179-213 Region 179-213 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false