DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dovey-2010-1 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221011X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions imex curation dovey-2010-2 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221015X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions imex curation dovey-2010-3 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221020X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions imex curation dovey-2010-4 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221019X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions imex curation dovey-2010-5 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221012X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions imex curation dovey-2010-6 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221021X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions imex curation dovey-2010-7 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221016X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions imex curation dovey-2010-8 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221013X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions imex curation dovey-2010-9 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221014X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions imex curation dovey-2010-10 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221017X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions imex curation dovey-2010-11 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221022X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions imex curation dovey-2010-12 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221018X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions imex curation dovey-2010-13 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dovey OM., Foster CT., Cowley SM. DIP original experiment: DIP-221023X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Histone deacetylase 1 (HDAC1), but not HDAC2, controls embryonic stem cell differentiation. Dovey OM., Foster CT., Cowley SM. Only protein-protein interactions imex curation hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA sin3a_mouse Paired amphipathic helix protein Sin3a Sin3a Kiaa4126 Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein mouse Mus musculus Mouse MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAPNYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHSGTGATPPVKKKPKLMSLKESSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQVTDLYLAENNNGATGGQLNSQTSRSLLESAYQRKAEQLMSDENCFKLMFIQSQGQVQLTVELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVESLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP hdac2_mouse Histone deacetylase 2 Hdac2 Yy1bp YY1 transcription factor-binding protein protein protein mouse Mus musculus Mouse MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVAKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDPKGAKSEQLSNP mta2_mouse Metastasis-associated protein MTA2 Mta2 Mta1l1 Metastasis-associated 1-like 1 protein protein mouse Mus musculus Mouse MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILNQYLDKEDCFFYSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLTQNRGLGGIMVKRSYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLMTVRPPVPLPASSHPASTNEPIVLED kdm1a_mouse Lysine-specific histone demethylase 1A Kdm1a Kiaa0601 Lsd1 Flavin-containing amine oxidase domain-containing protein 2 BRAF35-HDAC complex protein BHC110 Aof2 protein protein mouse Mus musculus Mouse MLSGKKAAAAAAAAAAAAAAGTEAGSGAAGGAENGSEVAAPPAGLTGPTDMATGAAGERTPRKKEPPRASPPGGLAEPPGSAGPQAGPTAGPGSATPMETGIAETPEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPIKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM sin3a-hdac1-5 3207594 N/A 3207607 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207608 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false hdac2-hdac1-3 3207595 N/A 3207608 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207609 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3207610 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207611 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207607 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false mta2-hdac1-8 3207596 N/A 3207607 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207610 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false hdac2-mta2-1 3207597 N/A 3207609 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3207610 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false mta2-hdac1-9 3207598 N/A 3207609 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207607 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207610 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association false false false kdm1a-hdac1-1 3207599 N/A 3207611 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3207607 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false sin3a-hdac2-2 3207600 N/A 3207609 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207608 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false kdm1a-hdac1-2 3207601 N/A 3207611 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3207609 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207607 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false hdac1-hdac2-10 3207602 N/A 3207609 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207610 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207611 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207607 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3207608 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false mta2-hdac2-1 3207603 N/A 3207609 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207610 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false sin3a-hdac1-6 3207604 N/A 3207609 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207607 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207608 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association false false false kdm1a-hdac2-1 3207605 N/A 3207611 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3207609 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false hdac1-kdm1a-1 3207606 N/A 3207610 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207611 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3207607 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3207608 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false