DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hernandez_valladares-2010-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217065X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions imex curation hernandez_valladares-2010-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217063X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions imex curation hernandez_valladares-2010-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217061X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions imex curation hernandez_valladares-2010-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217067X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions imex curation hernandez_valladares-2010-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217062X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions imex curation hernandez_valladares-2010-6 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217064X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions imex curation hernandez_valladares-2010-7 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217066X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions imex curation hernandez_valladares-2010-8 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. DIP original experiment: DIP-217068X Nature structural & molecular biology 2010 IMEx Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Hernandez-Valladares M., Kim T., Kannan B., Tung A., Aguda AH., Larsson M., Cooper JA., Robinson RC. Only protein-protein interactions imex curation q5vzk9-1 F-actin-uncapping protein LRRC16A CARMIL1 CARMIL LRRC16 LRRC16A CARMIL homolog Capping protein regulator and myosin 1 linker protein 1 Capping protein, Arp2/3 and myosin-I linker homolog 1 Capping protein, Arp2/3 and myosin-I linker protein 1 Leucine-rich repeat-containing protein 16A CARMIL1a protein protein human Homo sapiens Human MTEESSDVPRELIESIKDVIGRKIKISVKKKVKLEVKGDKVENKVLVLTSCRAFLVTARIPTKLELTFSYLEIHGVVCSKSAQMIVETEKCSISMKMASPEDVSEVLAHIGTCLRKIFPGLSPVRIMKKVSMEPSERLASLQALWDSQTVAEQGPCGGFSQMYACVCDWLGFSYREEVQWDVDTIYLTQDTRELNLQDFSHLDHRDLIPIIAALEYNQWFTKLSSKDLKLSTDVCEQILRVVSRSNRLEELVLENAGLRTDFAQKLASALAHNPNSGLHTINLAGNPLEDRGVSSLSIQFAKLPKGLKHLNLSKTSLSPKGVNSLSQSLSANPLTASTLVHLDLSGNVLRGDDLSHMYNFLAQPNAIVHLDLSNTECSLDMVCGALLRGCLQYLAVLNLSRTVFSHRKGKEVPPSFKQFFSSSLALMHINLSGTKLSPEPLKALLLGLACNHNLKGVSLDLSNCELRSGGAQVLEGCIAEIHNITSLDISDNGLESDLSTLIVWLSKNRSIQHLALGKNFNNMKSKNLTPVLDNLVQMIQDEESPLQSLSLADSKLKTEVTIIINALGSNTSLTKVDISGNGMGDMGAKMLAKALQINTKLRTVIWDKNNITAQGFQDIAVAMEKNYTLRFMPIPMYDASQALKTNPEKTEDALQKIENYLLRNHETRKYLQEQAYRLQQGIVTSTTQQMIDRICVKVQDHLNSLRNCGGDAIQEDLKSAERLMRDAKNSKTLLPNLYHVGGASWAGASGLLSSPIQETLESMAGEVTRVVDEQLKALLESMVDAAENLCPNVMKKAHIRQDLIHASTEKISIPRTFVKNVLLEQSGIDILNKISEVKLTVASFLSDRIVDEILDALSHCHHKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDLDKALEEVPIHIEDPPFPSLRQEKRSSGFISELPSEEGKKLEHFTKLRPKRNKKQQPTQAAVCAANIVSQDGEQNGLMGRVDEGVDEFFTKKVTKMDSKKWSTRGSESHELNEGGDEKKKRDSRKSSGFLNLIKSRSKSERPPTILMTEEPSSPKGAVRSPPVDCPRKDTKAAEHNGNSERIEEIKTPDSFEESQGEEIGKVERSDSKSSPQAGRRYGVQVMGSGLLAEMKAKQEKRAACAQKKLGNDAVSQDSSSPALSGVERSDGGGAVPKLHPGLPENRFGLGTPEKNTKAEPKAEAGSRSRSSSSTPTSPKPLLQSPKPSLAARPVIPQKPRTASRPDDIPDSPSSPKVALLPPVLKKVPSDKERDGQSSPQPSPRTFSQEVSRRSWGQQAQEYQEQKQRSSSKDGHQGSKSNDSGEEAEKEFIFV p14315-1 F-actin-capping protein subunit beta isoforms 1 and 2 CAPZB Beta-actinin subunit II CapZ 36/32 CapZ B1 and B2 Beta-1 protein protein chick Gallus gallus (Chicken) Chicken MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQIYIQPDN caza1_chick F-actin-capping protein subunit alpha-1 CAPZA1 CapZ 36/32 Beta-actinin subunit I protein protein chick Gallus gallus (Chicken) Chicken MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQWRDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA cd2ap_human CD2-associated protein CD2AP Cas ligand with multiple SH3 domains Adapter protein CMS protein protein human Homo sapiens Human MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETEFKDDSLPIKRERHGNVASLVQRISTYGLPAGGIQPHPQTKNIKKKTKKRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAYEGTNEDELTFKEGEIIHLISKETGEAGWWRGELNGKEGVFPDNFAVQINELDKDFPKPKKPPPPAKAPAPKPELIAAEKKYFSLKPEEKDEKSTLEQKPSKPAAPQVPPKKPTPPTKASNLLRSSGTVYPKRPEKPVPPPPPIAKINGEVSSISSKFETEPVSKLKLDSEQLPLRPKSVDFDSLTVRTSKETDVVNFDDIASSENLLHLTANRPKMPGRRLPGRFNGGHSPTHSPEKILKLPKEEDSANLKPSELKKDTCYSPKPSVYLSTPSSASKANTTAFLTPLEIKAKVETDDVKKNSLDELRAQIIELLCIVEALKKDHGKELEKLRKDLEEEKTMRSNLEMEIEKLKKAVLSS capza1-capzb-4 3206611 N/A 3206619 unspecified role unspecified role unspecified role unspecified role CP-binding region 115 Region 964-1078 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206620 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206621 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false capza1-capzb-5 3206612 N/A 3206619 unspecified role unspecified role unspecified role unspecified role CP-binding region 52 Region 961-1012 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3206620 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206621 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false capza1-capzb-6 3206613 N/A 3206620 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206621 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false capza1-capzb-7 3206614 N/A 3206622 unspecified role unspecified role unspecified role unspecified role CP interaction motif Region 474-506 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3206620 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206621 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false capza1-capzb-8 3206615 N/A 3206619 unspecified role unspecified role unspecified role unspecified role CP-binding region 37 Region 968-1004 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3206620 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206621 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false capza1-capzb-9 3206616 N/A 3206619 unspecified role unspecified role unspecified role unspecified role CP-binding region 52 Region 961-1012 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3206620 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206621 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false capza1-capzb-10 3206617 N/A 3206619 unspecified role unspecified role unspecified role unspecified role CP-binding region 115 Region 964-1078 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206620 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206621 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false capza1-capzb-11 3206618 N/A 3206622 unspecified role unspecified role unspecified role unspecified role CP interaction motif Region 474-506 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3206620 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206621 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false