DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sciara-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. DIP original experiment: DIP-220975X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure of lactococcal phage p2 baseplate and its mechanism of activation. Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. Only protein-protein interactions imex curation sciara-2010-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. DIP original experiment: DIP-220971X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure of lactococcal phage p2 baseplate and its mechanism of activation. Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. Only protein-protein interactions imex curation sciara-2010-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. DIP original experiment: DIP-220973X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure of lactococcal phage p2 baseplate and its mechanism of activation. Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. Only protein-protein interactions imex curation sciara-2010-4 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. DIP original experiment: DIP-220978X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure of lactococcal phage p2 baseplate and its mechanism of activation. Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. Only protein-protein interactions imex curation sciara-2010-5 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. DIP original experiment: DIP-220972X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure of lactococcal phage p2 baseplate and its mechanism of activation. Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. Only protein-protein interactions imex curation sciara-2010-6 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. DIP original experiment: DIP-220976X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure of lactococcal phage p2 baseplate and its mechanism of activation. Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. Only protein-protein interactions imex curation sciara-2010-7 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. DIP original experiment: DIP-220974X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure of lactococcal phage p2 baseplate and its mechanism of activation. Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. Only protein-protein interactions imex curation sciara-2010-8 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. DIP original experiment: DIP-220977X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure of lactococcal phage p2 baseplate and its mechanism of activation. Sciara G., Bebeacua C., Bron P., Tremblay D., Ortiz-Lombardia M., Lichière J., van Heel M., Campanacci V., Moineau S., Cambillau C. Only protein-protein interactions imex curation gp16_bplp2 Baseplate protein gp16 Gene product 16 Tail-associated lysine-like protein protein protein bplp2 bplp2 Lactococcus lactis bacteriophage p2 MLEANVYDNFNPNYYNISDFSMPNGKKEKRGLPIPKARCQVINYELWETGYLYTSSATLTVSVEVGDIVQILFPEVVPIEEALGKKKKLNLDMVYLVTDVDESNKATLKNYFWAMIESLDVPNAITKTTNFAIIDYLIDPNKNNLMSYGYFFNSSIFAGKATINRKAETSSAHDVAKRIFSKVQFQPTTTIQHAPSETDPRNLLFINFASRNWNRKRITTRVDIKQSVTMDTETIVERSAYNFAVVFVKNKATDDYTDPPKMYIAKNNGDVIDYSTYHGDGTDLPDVRTAKTLFYDRDDHGNPPELSTIKVEISPSTIVTRLIFNQNELLPLYVNDLVDIWYEGKLYSGYIADRVKTEFNDRLIFVESGDKPNVI This sequence has been withdrawn from Uniprot. D07CB9AFE7A4F20F dit_bplp2 Distal tail protein Gene product 15 protein protein bplp2 bplp2 Lactococcus lactis bacteriophage p2 MVRQYKIHTNLDGTDDKVWDVTNGKVRFYQPSNLGLQSTNNIWQSNGIGVMGTRSITQPQIEFKLETFGESLEENYQLMKDFVNDILSKKFVTLEYQTEIFQVYADLALADVTKTEGYGKNGTFSEKITFDIITKWYTYENLTFDKIQNGKVIAGMSKIYGGTAPGNYKYIKGTSYTYYGESDIDRLSRWDIKEEIFSFMGILYPKLPKTPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQGWKGTTALNLFPVMDFERYRTRIIEKGQMELINLSKAEFKIKRKADFV 3682A87D09DDA993 rbp_bplp2 Receptor binding protein rbp Gene product 18 protein protein bplp2 bplp2 Lactococcus lactis bacteriophage p2 MTIKNFTFFSPNSTEFPVGSNNDGKLYMMLTGMDYRTIRRKDWSSPLNTALNVQYTNTSIIAGGRYFELLNETVALKGDSVNYIHANIDLTQTANPVSLSAETANNSNGVDINNGSGVLKVCFDIVTTSGTGVTSTKPIVQTSTLDSISVNDMTVSGSIDVPVQTLTVEAGNGLQLQLTKKNNDLVIVRFFGSVSNIQKGWNMSGTWVDRPFRPAAVQSLVGHFAGRDTSFHIDINPNGSITWWGANIDKTPIATRGNGSYFIK 6D2F7356D7C34853 orf15-orf16-1 3206503 N/A 3206511 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206512 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false orf15-orf16-2 3206504 N/A 3206513 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206511 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206512 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false orf15-orf16-3 3206505 N/A 3206513 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206511 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206512 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false orf15-orf16-4 3206506 N/A 3206513 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206511 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206512 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false orf15-orf16-5 3206507 N/A 3206513 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3206511 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3206512 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false orf15-orf16-6 3206508 N/A 3206511 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206512 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false orf15-orf16-7 3206509 N/A 3206513 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206511 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206512 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false orf15-orf16-8 3206510 N/A 3206511 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3206512 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false