DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kndler-2010-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. DIP original experiment: DIP-254185X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coordination of Rab8 and Rab11 in primary ciliogenesis. Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. Only protein-protein interactions imex curation kndler-2010-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. DIP original experiment: DIP-254189X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coordination of Rab8 and Rab11 in primary ciliogenesis. Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. Only protein-protein interactions imex curation kndler-2010-3 in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange predetermined predetermined participant predetermined Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. DIP original experiment: DIP-254187X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coordination of Rab8 and Rab11 in primary ciliogenesis. Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. Only protein-protein interactions imex curation kndler-2010-4 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. DIP original experiment: DIP-254186X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coordination of Rab8 and Rab11 in primary ciliogenesis. Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. Only protein-protein interactions imex curation kndler-2010-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. DIP original experiment: DIP-254188X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Coordination of Rab8 and Rab11 in primary ciliogenesis. Knödler A., Feng S., Zhang J., Zhang X., Das A., Peränen J., Guo W. Only protein-protein interactions imex curation q96qf0-2 Rab-3A-interacting protein alpha1 RAB3IP Rabin-3 SSX2-interacting protein RABIN8 protein protein human Homo sapiens Human MANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQANALDVSELPTQPVYSSPRRLNCAEISSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFKKGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL rb11a_human Ras-related protein Rab-11A YL8 RAB11A RAB11 protein protein human Homo sapiens Human MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI rab3i_human Rab-3A-interacting protein Rabin-3 SSX2-interacting protein RAB3IP RABIN8 protein protein human Homo sapiens Human MGLKKMKGLSYDEAFAMANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQANALDVSELPTQPVYSSPRRLNCAEISSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFKKGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL bbs1_human Bardet-Biedl syndrome 1 protein BBS1 BBS2L2 BBS2-like protein 2 protein protein human Homo sapiens Human MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVIHTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSEVGPPPAQAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARAYLQALESSLSPLSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTTRPVLGLLVCFLYNEALYSLPRAFFKVPLLVPGLNYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLAAA rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL rab3ip-rab11a-3 3206327 N/A 3206332 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3206333 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P62491:p.Gln70Leu Q70L mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P62491:p.Ser25Asn S25N mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rab3ip-bbs1-3 3206328 N/A 3206334 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3206335 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false rab3ip-rab8a-3 3206329 N/A 3206336 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3206332 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rab3ip-rab11a-4 3206330 N/A 3206332 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Region 1-331 Region 1-331 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206333 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false rab3ip-bbs1-4 3206331 N/A 3206335 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3206332 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Region 1-331 Region 1-331 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false