DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ragusa-2010-1 in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. DIP original experiment: DIP-217055X Nature structural & molecular biology 2010 IMEx Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites. Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. Only protein-protein interactions imex curation ragusa-2010-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. DIP original experiment: DIP-217057X Nature structural & molecular biology 2010 IMEx Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites. Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. Only protein-protein interactions imex curation ragusa-2010-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. DIP original experiment: DIP-217053X Nature structural & molecular biology 2010 IMEx Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites. Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. Only protein-protein interactions imex curation ragusa-2010-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. DIP original experiment: DIP-217059X Nature structural & molecular biology 2010 IMEx Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites. Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. Only protein-protein interactions imex curation ragusa-2010-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. DIP original experiment: DIP-217056X Nature structural & molecular biology 2010 IMEx Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites. Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. Only protein-protein interactions imex curation ragusa-2010-6 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. DIP original experiment: DIP-217054X Nature structural & molecular biology 2010 IMEx Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites. Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. Only protein-protein interactions imex curation ragusa-2010-7 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. DIP original experiment: DIP-217058X Nature structural & molecular biology 2010 IMEx Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites. Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. Only protein-protein interactions imex curation ragusa-2010-8 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. DIP original experiment: DIP-217060X Nature structural & molecular biology 2010 IMEx Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites. Ragusa MJ., Dancheck B., Critton DA., Nairn AC., Page R., Peti W. Only protein-protein interactions imex curation gria1_human Glutamate receptor 1 GRIA1 GLUH1 GLUR1 AMPA-selective glutamate receptor 1 Glutamate receptor ionotropic, AMPA 1 GluR-A GluR-K1 protein protein human Homo sapiens Human MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL mint Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist pp1a_human Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA PPP1A protein protein human Homo sapiens Human MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK neb2_rat Neurabin-2 Ppp1r9b Neurabin-II Neural tissue-specific F-actin-binding protein II p130 PP1bp134 Protein phosphatase 1 regulatory subunit 9B Spinophilin Spino protein protein rat Rattus norvegicus (Rat) Rat MMKTEPRGPGGPLRSASPHRSAYEAGIQALKPPDAPGPDEAPKAAHHKKYGSNVHRIKSMFLQMGTTTGPPGEAGGASGMAEAPRASDRGVRLSLPRASSLNENVDHSALLKLGTSVSERVSRFDSKPAPSAQPAPPPHPPSRLQETRKLFERSVPAASGGDKEAVARRLLRQERASLQDRKLDVVVRFNGSTEALDKLDADAVSPTVSQLSAVFEKADSRTGLHRAPGPPRAAGAPQVNSKLVTKRSRVFQPPPPPPAPSGDAATEKDRGPGGQQPPQHRVAPARPPPKPREVRKIKPVEVEESGESEAESAPGEVIQAEVTVHAALENGSTTATTASPAPEEPKAEAVPEEEASSSVATLERGVDNGRAPDMAPEEVDESKKEDFSEADLVDVSAYSGLGEDSGGSALEEDDEEDEEDGEPPYEPESGCVEIPGLSEEEDPAPSRKIHFSTAPIQVFSTYSNEDYDRRNEDVDPMAASAEYELEKRVERLELFPVELEKDSEGLGISIIGMGAGADMGLEKLGIFVKTVTEGGAAHRDGRIQVNDLLVEVDGTSLVGVTQSFAASVLRNTKGRVRFMIGRERPGEQSEVAQLIQQTLEQERWQREMMEQRYAQYGEDDEETGEYATDEDEELSPTFPGGEMAIEVFELAENEDALSPVEMEPEKLVHKFKELQIKHAVTEAEIQQLKRKLQSLEQEKGRWRVEKAQLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEFLKKETAQRRVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST neb1_rat Neurabin-1 Ppp1r9a Neurabin-I p180 PP1bp175 Neural tissue-specific F-actin-binding protein I Protein phosphatase 1 regulatory subunit 9A protein protein rat Rattus norvegicus (Rat) Rat MLKAESSGERTTLRSASPHRNAYRTEFQALKSTFDKPKPDGEQKTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAIIAKTRGKGRPSSPQKRMKPKEFVEKTDGSVVKLESSVSERISRFDTMHDGPSYAKFTETRKMFERSGHESGQNNRHSPKKEKAGEAEPQDEWGGSKSNRGSSDSLDSLSPRTEAVSPTVSQLSAVFENSESPGAITPGKAENSNYSVTGHYPLNLPSVTVTNLDTFGRLKDSNSRPSSNKQATDTEEPEKSEAVPVPEVAQKGTSLASLPSEERQLSTEAEDVTAQPDTPDSTDKDSPGEPSAESQAMPKSNTLSRPKEPLEDAEANVVGSEAEQPQRRDLTGGGDLTSPDASASSCGKEVPEDSNSFEGSHVYMHSDYNVYRVRSRYNSDWGETGTEQDEGDDSDENNYYQPDMEYSEIVGLPQEEEIPANRKIKFSCAPIKVFNTYSNEDYDRRNDDVDPVAASAEYELEKRVEKLELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTEGGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAATVLRNTKGNVRFVIGREKPGQVSEVAQLISQTLEQERRQRELLERHYAQYDADDDETGEYATDEEEDEVGPILPGGDMAIEVFELPENEDMFSPSDLDTSKLSHKFKELQIKHAVTEAEIQKLKTKLQAAENEKVRWELEKNQLQQNIEENKERMVKLESYWIEAQTLCHTVNEHLKETQSQYQALEKKYNKAKKLIKDFQQKELDFIRRQEVERKKLEEVEKAHLVEVQGLQVRIRDLEAEVFRLLKQNGTQVNNNNNIFERRPSPGEVSKGDTMENVEVKQTSCQDGLSQDLNEAVPETERLDSKALKTRAQLSVKNRRQRPTRTRLYDSVSSTDGEDSLERKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMIDDEILDDGQSPKHTQSQSRAVHEWSVQQVSHWLVGLSLDQYVSEFSAQNISGEQLLQLDGNKLKALGMTSSQDRALVKKKLKEMKMSLEKARKAQEKMEKQREKLRRKEQEQMQRKSKKSEKMTSTTEQP mint Binds to actin filaments (F-actin) and shows cross-linking activity. Binds along the sides of the F-actin. May be involved in neurite formation. Inhibits protein phosphatase 1-alpha activity. May play an important role in linking the actin cytoskeleton to the plasma membrane at the synaptic junction gria1-ppp1ca-1 3206235 N/A 3206243 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 809-889 Region 809-889 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206244 enzyme enzyme unspecified role unspecified role Region 7-330 Region 7-330 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation false false false ppp1ca-ppp1r9b-2 3206236 N/A 3206245 unspecified role unspecified role unspecified role unspecified role PP1-binding and PDZ domains Region 417-583 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206244 unspecified role unspecified role unspecified role unspecified role Region 7-330 Region 7-330 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ppp1ca-ppp1r9b-3 3206237 N/A 3206245 unspecified role unspecified role unspecified role unspecified role PP1-binding and PDZ domains Region 417-583 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206244 unspecified role unspecified role unspecified role unspecified role Region 7-330 Region 7-330 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ppp1ca-ppp1r9a-1 3206238 N/A 3206246 unspecified role unspecified role unspecified role unspecified role PP1-binding domain Region 426-592 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206244 unspecified role unspecified role unspecified role unspecified role Region 7-330 Region 7-330 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ppp1ca-ppp1r9b-4 3206239 N/A 3206245 unspecified role unspecified role prey prey PP1-binding and PDZ domains Region 417-583 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false O35274:p.Phe451Ala F451A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206244 unspecified role unspecified role bait bait Region 7-330 Region 7-330 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ppp1ca-ppp1r9b-6 3206240 N/A 3206245 unspecified role unspecified role unspecified role unspecified role PP1-binding and PDZ domains Region 417-583 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206244 unspecified role unspecified role unspecified role unspecified role Region 7-330 Region 7-330 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ppp1ca-ppp1r9a-2 3206241 N/A 3206246 unspecified role unspecified role unspecified role unspecified role PP1-binding domain Region 426-592 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206244 unspecified role unspecified role unspecified role unspecified role Region 7-330 Region 7-330 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ppp1ca-ppp1r9a-3 3206242 N/A 3206246 unspecified role unspecified role prey prey PP1-binding domain Region 426-592 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206244 unspecified role unspecified role bait bait Region 7-330 Region 7-330 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false