DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ freudenthal-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Freudenthal BD., Gakhar L., Ramaswamy S., Washington MT. DIP original experiment: DIP-217045X Nature structural & molecular biology 2010 IMEx Structure of monoubiquitinated PCNA and implications for translesion synthesis and DNA polymerase exchange. Freudenthal BD., Gakhar L., Ramaswamy S., Washington MT. Only protein-protein interactions imex curation freudenthal-2010-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Freudenthal BD., Gakhar L., Ramaswamy S., Washington MT. DIP original experiment: DIP-217046X Nature structural & molecular biology 2010 IMEx Structure of monoubiquitinated PCNA and implications for translesion synthesis and DNA polymerase exchange. Freudenthal BD., Gakhar L., Ramaswamy S., Washington MT. Only protein-protein interactions imex curation freudenthal-2010-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Freudenthal BD., Gakhar L., Ramaswamy S., Washington MT. DIP original experiment: DIP-217048X Nature structural & molecular biology 2010 IMEx Structure of monoubiquitinated PCNA and implications for translesion synthesis and DNA polymerase exchange. Freudenthal BD., Gakhar L., Ramaswamy S., Washington MT. Only protein-protein interactions imex curation freudenthal-2010-4 ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Freudenthal BD., Gakhar L., Ramaswamy S., Washington MT. DIP original experiment: DIP-217047X Nature structural & molecular biology 2010 IMEx Structure of monoubiquitinated PCNA and implications for translesion synthesis and DNA polymerase exchange. Freudenthal BD., Gakhar L., Ramaswamy S., Washington MT. Only protein-protein interactions imex curation pcna_yeast Proliferating cell nuclear antigen YBR0811 YBR088C POL30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE 9B56C5851621DDDC pcna-11 3206195 N/A 3206199 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pcna-pcna-4 3206196 N/A 3206199 unspecified role unspecified role unspecified role unspecified role C-terminal fragment Region 164-258 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206199 unspecified role unspecified role unspecified role unspecified role N-terminal fragment Region 1-163 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pcna-pcna-5 3206197 N/A 3206199 unspecified role unspecified role unspecified role unspecified role C-terminal fragment Region 164-258 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206199 unspecified role unspecified role unspecified role unspecified role N-terminal fragment Region 1-163 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pcna-pcna-6 3206198 N/A 3206199 unspecified role unspecified role prey prey C-terminal fragment Region 164-258 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3206199 unspecified role unspecified role bait bait N-terminal fragment Region 1-163 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false