DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dimattia-2010-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined DiMattia MA., Watts NR., Stahl SJ., Rader C., Wingfield PT., Stuart DI., Steven AC., Grimes JM. DIP original experiment: DIP-217103X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Implications of the HIV-1 Rev dimer structure at 3.2 A resolution for multimeric binding to the Rev response element. DiMattia MA., Watts NR., Stahl SJ., Rader C., Wingfield PT., Stuart DI., Steven AC., Grimes JM. Only protein-protein interactions imex curation rev_hv1b1 Protein Rev rev ART/TRS Anti-repression transactivator Regulator of expression of viral proteins protein protein hv1b1 Human immunodeficiency virus type 1 group M subtype B (isolate BH10) (HIV-1) HIV-1 MAGRSGDSDEDLLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILSTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGAKE rev-1 3206109 N/A 3206110 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false