DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ryan-2010-1 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216385X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216376X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216367X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-4 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216389X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-5 xanc8 Xanthomonas campestris pv. campestris (strain 8004) fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216382X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216372X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216381X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216368X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-9 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216384X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216373X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-11 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216388X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216379X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216369X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-14 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216374X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216380X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-16 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216377X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-17 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216370X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-18 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216387X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-19 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216378X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-20 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216375X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-21 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216371X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-22 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216386X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation ryan-2010-23 xanc8 Xanthomonas campestris pv. campestris (strain 8004) fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. DIP original experiment: DIP-216383X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Cell-cell signal-dependent dynamic interactions between HD-GYP and GGDEF domain proteins mediate virulence in Xanthomonas campestris. Ryan RP., McCarthy Y., Andrade M., Farah CS., Armitage JP., Dow JM. Only protein-protein interactions imex curation a0a0h2x560_xanc8 GGDEF domain-containing protein XC_0613 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MLLDDPTAALQATDRQLRQARASGQADATFWAALAQARVLISLEDSARRNQALTQARDVLGQLHGSGAQARLWLHTVQALSDVRENPNRSMVARLEELRRQARALGRRDLLCEVDAVDMWSMLASGSSDEAWNAAQASYQCAVREGSLSLELDALTQLGSLASRVGGRTAKENEAEAYLLRALARLGDLPARFQRSLIEYEYGASLALQQPDAALVHFRRALALSRALGDQAGVAAALTSASEALIETGDAAAALVTANEALPLMQAQGNIGRVAACHAVLLKAMTALTDARLGEEIAAARRADGPQLASSRRVDLADAIAAALASMGQHAQAYAELQRANALRERSQEGQRDTVMLRLQARYEDARRSAETAELRRRSETAQLALQAREAGQRTLWIALCAACLLLIAALVVVAVGWRHRRQLSTLAMRDELTGLPNRRAIRTEAQQQIEHALRTRTSCMLALIDLDHFKQINDVHGHATGDAVLKALAAASRRALRERDQLGRLGGEEFLLVLPGCTADEIGNVFARLRSAVAAIAIAGLPADAPVRFCLGAVRVTPATGLDVLLSQADLALYAAKTAGRDQWAVYGA rpfg_xanc8 Cyclic di-GMP phosphodiesterase response regulator RpfG rpfG XC_2335 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MQDVLGNPAGVSSAETWGSWSEKADLGLNIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALSWCEAGRVDLLLLDYRMPGMDGLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLLQLRQQSESVKQRALSLEQRLLASMNEVEERERETLSRLARAIEYRDGGTSAFLERMSHVAGLVAEQLGLSEEEVRIIEMAAPLHDMGKIAIPDSVLLKPGKLTEDEMNVMKRHPRIGYELLSGSQNRFIQVGALIALRHHERYDGSGYPDGLVGEAIPLEARIVAVADVFDALLSARPYKEAWTMDAALAYLYAQRGRLFDPRCVDALLRGRAQLEQICGQFSTASARPGV a0a0h2x3k2_xanc8 GGDEF domain-containing protein XC_0420 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MAEQPEHPNRPRGGLRRLLPWGGAGTARPATLPSVLGERDGAGLAAHQLVPAKAKSGAHDPAAATALLIRLFSHAAHPEALLLAFAEGIASLHGELGDMGVRLSTAYAAGDWPGYGRALRQLIDKYIRTIDTGDSLAEGRTEAEQLRDLLRHALGNALATLLQRSPELAEEAQTLASALRHWRPGHELITLEQRLRELSHQIGLRAEDASEQQNLLLGLFDLLLENVGELLDDRSWLQGQISVVRQLIAGPMDVGSIEQARGTLREVIYKQGLLKQGIADSKTAMREMMVSFVDRLDGMATSTGEYHDRVAGYSQAIGDARSIPDLNRLLQDVLQDTAGVQAQALAARDELLSARRQVEEAEHRIASLEQELKDVAGLVREDQLTGALNRRGFEELFEREATRTQRSGQPLCVAMLDLDDFRRLNETHGHAGGDAALRHTVDVAKSVLRTTDAIARFGGEEFVLLLPDSTIFEASAAVIRLQRALAQRSLLHEDVRVFVSFSGGVAMRRTDEAQDEVIRRADRAMYDSKAAGKNRVISAD a0a0h2x359_xanc8 XC_0249 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MTCHTSNGAVEPTGSVAKTLSDGLHALMTAEELAFFARFGRMREIAAGQALFERGAVGTQMFIVVTGQIDLDFGEDLMLKHLGPGEFFGELGLLIGDHARSAGASASVDSRLIELAHDDFQRLVDHDPSMVAHFLRRSIVRVVNNEQLLIRQLRRRNHDLEAALDNLYVTSHQLNHTEELSRTDELTGLHNRRGLALHLQECRRGGGAPGVGLILIDCDRFKHINDEYGHLAGDRVLQNVAHALRSVIAEGDLVCRLGGDEFCVLVAQGSIELVQHMGECIVNAVQARQASSPDGCHSCSVSVGVCSIDASTSYNDWYTRADTALYQAKRQGGNSLCVYEALPLDNS a0a0h2x7k9_xanc8 XC_2274 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MPTLPALLALLLPRRGSLRARPWLPAVCMLVLALLGTAGAAHAQTFSFREYDQADGLQGMSVNGILEDRNGAVWVATETALHRFERDRFVPVGAEQGLDARYTRALTLDRAGRLWVATANGVFVRIGERFEQVHYNGKRIRADAGNVIAAYRNGVAVVSDNTLLALTPAAVTGWQVQPLPLRAADGTVLPPRRALLADGNDLWVACAATVCRLDAHGTLVEVLSDEEGVPAKRWRVIFRDRAGRLWLRGGGLIISRGPGEGRFRSHPSSAQATFNTLSGATTMVEDPQGRLLTRADHGLVRWQDGHWTAIGADQGLHLDAMVGPLLQQSTGTLWIGTRGMGIQRWLGYGSIEHLTEAQGMAAAPTWAIQRLPDGTLAVGADGGGSLLPAQAQRAQPWLQHDGQPLPQALAIAVAPDGAGWVSFFSGAIARRDPITGQTRRVMDLPSPVYKLVFDRSGTLWMATPRGIYHGSSQAPYPLAPDVALAGTFIGDLDLDAQGRLWAATADGLYRRDGNRWVQVPVHGDLPSQDLFQLDFAADGELWVSLREVGLWHGRVQPDGSVALQAVTDPLVSKVMPFILRHDRKGRLWVGSSQGLDLYQHGHWSRITRAEGLLWDDMSANAFFEDTDGSIWIGSSRGLSHLRQPERLFAAPPLRVEIAQVQRGERSLRADASVGWSETPLEIDLRTPGVEGGPERISFRYRVEGRQARWTTTSLSHITYPLLPPGNYTLEVQALDAYQRSASPIAQFAFALRPPWWRSALAIVAYVLAGIGGVVALLRWRTRKLLARKQELEHLIAERTAELEQDKRDLEAARAALTHKATHDELTGLLNRAGILEALRGMLDSAPLREQPLAVVLIDLDYFKQVNDQHGHLAGDAVLAGVGKRLNALVRGNDRIGRYGGEELLALLPGLGADATHRLDALHAGICGDYPTGEVVLPITCSIGVAWRHPGDSVEHLLARADAALYLAKRNGRNRIAYDAAPQLHASDAARNADNAG a0a0h2x9j2_xanc8 XC_2949 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MHNGNDTRGDLVVLGPEGLYCPQGDFHIDPWRPVPRAVITHGHGDHARGGMGEYHCTRESLPILQWRLGEQVYHPHANGEAFTLGRARVSLHPAGHVLGSAQVRIEVDGQVWVASGDYKRQHDPTCAPFEVVPCDTFITEATFGLPVYRWPDTAQVAADIVAWRHECAARGEAAILYCYALGKAQRVLAELRAWDTQPALLHGAIAAGVEVYRHAGIAMLETQPVSEHARGADYAGQLVLAPPSAAGSPWIRRFRHAQQGFASGWMRIRGNRRRRNYDRGFVVSDHADWPDLLRTIADTGARRVIATHGNTDALIQHLREHGVAAEAFRTDFGAEE a0a0h2x979_xanc8 GGDEF domain-containing protein XC_2795 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MILHLRRDFRLGIVKMLGPITALLLCLYAVYLAMHGQGVACALTAALGLVAVWRGWRMRSAERTGRGGVWLASINVAGCLIGCWSGGDGALPWLFPVLATNYFLCGPQRAVLLSLPLLAALLLLPGLIVSPGQGISTVMVTLVTLAVGYAFSVRMQDDRVHLEELASLDALTGLPNRRMLERALTHQIDQRQPQDRLNSLIILDLDHFKDVNDLYGHAAGDAALADLATILRFEVREPYQVFRFGGEEFVVLLRAGSLAELEAATERLRKVIRNGLRGPGGRITVSLGAARHDGETHWQDWFSRADAALYLAKNGGRDSVRIAD a0a0h2x6p1_xanc8 GGDEF domain-containing protein XC_1803 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MGAPPPANEDDRLAALHSYNILDTAPEPLYDDITAAAAQLCRTPMALISLIDQDRQWFKSRVGMQPAETPRDLAFCAHAILQPDQMMEVGDTFVDPRFARNALVTGGPQIRFYAGAPLLTSDGVALGTLCVLDRAPRTLSDAERTALQALARQVVTTIELRQAARLLEGDALRDPLTDLWNREGLEHMLEDAAPVAKLHGLAFVLIEIDGFKRLKLQFGSDAADATLVQAARCIETEPQEPGGVARIGAAHFCMVLPGADSAQALASVQRLQTTIAAACWPADTISITAGLVCVAPGEPLDSHVLMARARHALLGAARAGRNCVQRFDGWQTDR a0a0h2x9f2_xanc8 GGDEF domain-containing protein XC_2866 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MIFEQARELAMLRSLRELQDVAEARRHADESENRMRHLAEQASRDALTGVFNRHQLGTALAHEFELATRQAWPLSIAFIDLDDFKRVNDAHGHLVGDEVLRNFAQTLQRMVRTSDLVARYGGEEFLVILPNTTAEAALMVIERILAETARTPMAQLPGGPLHITFSAGLATHGGGDRQFESIEHLLQAADTTLYRSKHRGRNRVTAYDATEVPAQPTPRAH a0a0h2xar9_xanc8 XC_2793 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MLTRKAKRHAAGALMLGGLIFVLIGVGGYITSRQSLTAAAWVSHTQEVIASIDEIQAGLLSAESSARGFVLTDNEAFLGVHADAIGRLPGRIARLEVLVQDNPLQLRNVAALDKLVDMRLVQINDLLHSYRATGLDGARASIAKGVFQTSSALRRQVQLMGELERRQLVSRTQANHDSARWVLWMTAIGILSGLLVMVLAYRLLSRELARRVRAEEEASTSSTRLAESFSTLERTSAGLEALARYSGLLQNCRNAEEALEITARTIAPLVPGVSGAVYLLRASRDRAEQVAAWGTLADGERGSIAPEECWALRRDRTHLVEDASVGMVCQHAGVNLPPHASTVCIPLSAQGTQLGMLALRGDNAQELASLTVAEAAAEQLSLALHNLRLRETLRQQSIRDPLTGLFNRRYLEEALNHELSRCTRRVQPLSVLMLDVDHFKQFNDLHGHSGGDRVLAAIGELLLAQTRGEDICCRYGGEELTIILPEVDLATASAMAEKLRAGIDGLQVMADGVSLPKITASFGVATFPGHAGNAAQLLRKADEALYRAKQAGRNQVVSAVTPGSV a0a0h2x5f3_xanc8 XC_0675 protein protein xanc8 Xanthomonas campestris pv. campestris (strain 8004) MPETWMRLYAGLSRLFPRSFSAKLLAVTFVGIHLPLLLLIAWLAAQSELDGRPLWSVVIVALLATLAGTALTLSALYRLLAPLRIAADALDAYYADQRLPTLPEHGDDELGRLLRGINRSLRGIDAGMRDLKRHALFDPLTEALNRRGCEQAMRDSVTAAQREGWPFVLFVLDMDNLKPINDRFGHLAGDRVLVRLVESAYGWLGAQDWIGRWGGDEFLIGVHASEDEATLKLNQWLSMLEREDAEEAPLHVSAGSAVCEVGIDATELYRRADAAMYRAKFSGGRRLVRDGHDAPRSHPVA xc_0613-rpfg-1 3294070 N/A 3294093 unspecified role unspecified role bait bait GGDEF domain Region 429-586 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3294094 unspecified role unspecified role prey prey HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false rpfg-xc_0420-1 3294071 N/A 3294095 unspecified role unspecified role prey prey GGDEF domain Region 382-537 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Gly294Ala G294A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Tyr295Ala Y295A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Pro296Ala P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rpfg-xc_0249-1 3294072 N/A 3294096 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rpfg-xc_0249-2 3294073 N/A 3294096 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false rpfg-xc_0249-3 3294074 N/A 3294096 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xanc8 Xanthomonas campestris pv. campestris (strain 8004) N/A 3294094 unspecified role unspecified role fluorescence donor fluorescence donor Q4UU85:p.Gly294Ala G294A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xanc8 Xanthomonas campestris pv. campestris (strain 8004) direct interaction direct interaction false false false rpfg-xc_2274-1 3294075 N/A 3294097 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rpfg-xc_2949-1 3294076 N/A 3294098 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Gly294Ala G294A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Tyr295Ala Y295A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Pro296Ala P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rpfg-xc_0420-2 3294077 N/A 3294095 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false xc_0249-rpfg-1 3294078 N/A 3294096 unspecified role unspecified role bait bait GGDEF domain Region 182-337 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3294094 unspecified role unspecified role prey prey HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false rpfg-xc_2795-1 3294079 N/A 3294099 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false xc_1803-rpfg-1 3294080 N/A 3294100 unspecified role unspecified role bait bait GGDEF domain Region 172-325 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3294094 unspecified role unspecified role prey prey HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false rpfg-xc_2866-1 3294081 N/A 3294101 unspecified role unspecified role prey prey GGDEF domain Region 44-204 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Gly294Ala G294A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Tyr295Ala Y295A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Pro296Ala P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rpfg-xc_0613-1 3294082 N/A 3294093 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rpfg-xc_2866-2 3294083 N/A 3294101 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rpfg-xc_2793-1 3294084 N/A 3294102 unspecified role unspecified role prey prey GGDEF domain Region 399-557 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Gly294Ala G294A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Tyr295Ala Y295A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Pro296Ala P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rpfg-xc_0613-2 3294085 N/A 3294093 unspecified role unspecified role prey prey GGDEF domain Region 429-586 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Gly294Ala G294A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Tyr295Ala Y295A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Pro296Ala P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rpfg-xc_0675-1 3294086 N/A 3294103 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false xc_0675-rpfg-1 3294087 N/A 3294103 unspecified role unspecified role bait bait GGDEF domain Region 136-288 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3294094 unspecified role unspecified role prey prey HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false rpfg-xc_1803-1 3294088 N/A 3294100 unspecified role unspecified role prey prey GGDEF domain Region 172-325 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Gly294Ala G294A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Tyr295Ala Y295A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Pro296Ala P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rpfg-xc_0249-4 3294089 N/A 3294096 unspecified role unspecified role prey prey GGDEF domain Region 182-337 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Gly294Ala G294A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Tyr295Ala Y295A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Pro296Ala P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.[Gly294Ala;Tyr295Ala;Pro296Ala] G294A/Y295A/P296A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false rpfg-xc_1803-2 3294090 N/A 3294100 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3294094 unspecified role unspecified role bait bait HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false xc_0420-rpfg-1 3294091 N/A 3294095 unspecified role unspecified role bait bait GGDEF domain Region 382-537 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3294094 unspecified role unspecified role prey prey HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false rpfg-xc_0420-3 3294092 N/A 3294095 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xanc8 Xanthomonas campestris pv. campestris (strain 8004) N/A 3294094 unspecified role unspecified role fluorescence donor fluorescence donor Q4UU85:p.Gly294Ala G294A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q4UU85:p.Gly294_Pro296delinsAlaAlaAla G294A/Y295A/P296A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false HD-GYP domain Region 172-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false xanc8 Xanthomonas campestris pv. campestris (strain 8004) direct interaction direct interaction false false false