DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chng-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chng SS., Ruiz N., Chimalakonda G., Silhavy TJ., Kahne D. DIP original experiment: DIP-216348X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Characterization of the two-protein complex in Escherichia coli responsible for lipopolysaccharide assembly at the outer membrane. Chng SS., Ruiz N., Chimalakonda G., Silhavy TJ., Kahne D. Only protein-protein interactions imex curation chng-2010-2 ecolx Escherichia coli pull down pull down anti tag western anti tag western blot anti tag western Chng SS., Ruiz N., Chimalakonda G., Silhavy TJ., Kahne D. DIP original experiment: DIP-216346X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Characterization of the two-protein complex in Escherichia coli responsible for lipopolysaccharide assembly at the outer membrane. Chng SS., Ruiz N., Chimalakonda G., Silhavy TJ., Kahne D. Only protein-protein interactions imex curation chng-2010-3 ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Chng SS., Ruiz N., Chimalakonda G., Silhavy TJ., Kahne D. DIP original experiment: DIP-216349X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Characterization of the two-protein complex in Escherichia coli responsible for lipopolysaccharide assembly at the outer membrane. Chng SS., Ruiz N., Chimalakonda G., Silhavy TJ., Kahne D. Only protein-protein interactions imex curation chng-2010-4 ecolx Escherichia coli pull down pull down western blot western blot Immuno blot Immuno blot Chng SS., Ruiz N., Chimalakonda G., Silhavy TJ., Kahne D. DIP original experiment: DIP-216347X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Characterization of the two-protein complex in Escherichia coli responsible for lipopolysaccharide assembly at the outer membrane. Chng SS., Ruiz N., Chimalakonda G., Silhavy TJ., Kahne D. Only protein-protein interactions imex curation lpte_ecoli LPS-assembly lipoprotein LptE lptE b0641 JW0636 Rare lipoprotein B rlpB protein protein ecoli Escherichia coli (strain K12) MRYLATLLLSLAVLITAGCGWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSDEEQTSTTTDTPATPARVSTTLGN lptd_ecoli LPS-assembly protein LptD lptD ostA b0054 yabG Organic solvent tolerance protein JW0053 imp protein protein ecoli Escherichia coli (strain K12) MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQGDTNDLPVTINADHAKGDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILDNGSFTSCLPGSDTWSVVGSEIIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGDKRRSGFLIPNAKYTTTNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQAGAGLMELDYLPSDKVYEDEHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYFNDFDNKYGSSTDGYATQKFSVGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYYQNDVGPFDTRIYGQAVHFVNTRDDMPEATRVHLEPTINLPLSNNWGSINTEAKLLATHYQQTNLDWYNSRNTTKLDESVNRVMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYVPYRDQSDIYNYDSSLLQSDYSGLFRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFNISVGQIYYFTESRTGDDNITWENDDKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNVATSNSSIEYRRDEDRLVQLNYRYASPEYIQATLPKYYSTAEQYKNGISQVGAVASWPIADRWSIVGAYYYDTNANKQADSMLGVQYSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIGFNIELRGLSSNYGLGTQEMLRSNILPYQNTL lptd-lpte-2 3205395 N/A 3205399 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3205400 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false lpte-lptd-2 3205396 N/A 3205399 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3205400 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false lptd-lpte-3 3205397 N/A 3205399 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3205400 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false lptd-lpte-4 3205398 N/A 3205399 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3205400 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false C-terminal domain Region 203-784 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false