DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cun-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Cun S., Sun H. DIP original experiment: DIP-216338X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx A zinc-binding site by negative selection induces metallodrug susceptibility in an essential chaperonin. Cun S., Sun H. Only protein-protein interactions imex curation cun-2010-2 ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Cun S., Sun H. DIP original experiment: DIP-216339X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx A zinc-binding site by negative selection induces metallodrug susceptibility in an essential chaperonin. Cun S., Sun H. Only protein-protein interactions imex curation ch10_helpy Co-chaperonin GroES groES 10 kDa chaperonin Chaperonin-10 groS hsp10 hspA mopB HP_0011 protein protein helpy Helicobacter pylori Campylobacter pylori MKFQPLGERVLVERLEEENKTSSGIIIPDNAKEKPLMGVVKAVSHKISEGCKCVKEGDVIAFGKYKGAEIVLDGTEYMVLELEDILGIVGSGSCCHTGNHDHKHAKEHEACCHDHKKH 5A965CD4C2FF014A mint Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter groes-1 3205388 N/A 3205390 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false groes-2 3205389 N/A 3205390 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false