DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhu-2010-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down predetermined predetermined participant predetermined Zhu Y., Hu L., Zhou Y., Yao Q., Liu L., Shao F. DIP original experiment: DIP-216316X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural mechanism of host Rab1 activation by the bifunctional Legionella type IV effector SidM/DrrA. Zhu Y., Hu L., Zhou Y., Yao Q., Liu L., Shao F. Only protein-protein interactions imex curation zhu-2010-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhu Y., Hu L., Zhou Y., Yao Q., Liu L., Shao F. DIP original experiment: DIP-216314X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural mechanism of host Rab1 activation by the bifunctional Legionella type IV effector SidM/DrrA. Zhu Y., Hu L., Zhou Y., Yao Q., Liu L., Shao F. Only protein-protein interactions imex curation zhu-2010-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down predetermined predetermined participant predetermined Zhu Y., Hu L., Zhou Y., Yao Q., Liu L., Shao F. DIP original experiment: DIP-216318X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural mechanism of host Rab1 activation by the bifunctional Legionella type IV effector SidM/DrrA. Zhu Y., Hu L., Zhou Y., Yao Q., Liu L., Shao F. Only protein-protein interactions imex curation zhu-2010-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhu Y., Hu L., Zhou Y., Yao Q., Liu L., Shao F. DIP original experiment: DIP-216315X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural mechanism of host Rab1 activation by the bifunctional Legionella type IV effector SidM/DrrA. Zhu Y., Hu L., Zhou Y., Yao Q., Liu L., Shao F. Only protein-protein interactions imex curation zhu-2010-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhu Y., Hu L., Zhou Y., Yao Q., Liu L., Shao F. DIP original experiment: DIP-216317X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural mechanism of host Rab1 activation by the bifunctional Legionella type IV effector SidM/DrrA. Zhu Y., Hu L., Zhou Y., Yao Q., Liu L., Shao F. Only protein-protein interactions imex curation p62820-1 Ras-related protein Rab-1A RAB1A RAB1 YPT1-related protein protein protein human Homo sapiens Human MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC gdib_human Rab GDP dissociation inhibitor beta Guanosine diphosphate dissociation inhibitor 2 GDI2 RABGDIB protein protein human Homo sapiens Human MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED drra_legpn Multifunctional virulence effector protein DrrA drrA sidM Defects in Rab1 recruitment protein A protein protein legpn Legionella pneumophila MSIMGRIKMSVNEEQFGSLYSDERDKPLLSPTAQKKFEEYQNKLANLSKIIRENEGNEVSPWQEWENGLRQIYKEMIYDAFDALGVEMPKDMEVHFAGSLAKAQATEYSDLDAFVIVKNDEDIKKVKPVFDALNNLCQRIFTASNQIYPDPIGINPSRLIGTPDDLFGMLKDGMVADVEATAMSILTSKPVLPRYELGEELRDKIKQEPSFSNMVSAKKFYNKAIKDFTAPKEGAEVVSVKTHIMRPIDFMLMGLREEFNLYSEDGAHLSAPGTIRLLREKNLLPEEQIARIESVYNQAMSKRFELHAEHKKEHDEMPYSDAKAMLDEVAKIRELGVQRVTRIENLENAKKLWDNANSMLEKGNISGYLKAANELHKFMKEKNLKEDDLRPELSDKTISPKGYAILQSLWGAASDYSRAAATLTESTVEPGLVSAVNKMSAFFMDCKLSPNERATPDPDFKVGKSKILVGIMQFIKDVADPTSKIWMHNTKALMNHKIAAIQKLERSNNVNDETLESVLSSKGENLSEYLSYKYATKDEGREHRYTASTENFKNVKEKYQQMRGDALKTEILADFKDKLAEATDEQSLKQIVAELKSKDEYRILAKGQGLTTQLLGLKTSSVSSFEKMVEETRESIKSQERQTIKIK gdi2-rab1a-1 3205072 N/A 3205077 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3205078 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false drra-rab1a-7 3205073 N/A 3205077 unspecified role unspecified role unspecified role unspecified role Region 1-177 Region 1-177 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3205079 unspecified role unspecified role unspecified role unspecified role Region 193-550 Region 193-550 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rab1a-gdi2-1 3205074 N/A 3205077 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3205078 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false drra-rab1a-8 3205075 N/A 3205077 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3205079 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 193-550 Region 193-550 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false drra-rab1a-9 3205076 N/A 3205077 unspecified role unspecified role unspecified role unspecified role Region 1-177 Region 1-177 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3205079 unspecified role unspecified role unspecified role unspecified role Region 193-550 Region 193-550 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false