DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lee-2010-9 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lee LK., Stewart AG., Donohoe M., Bernal RA., Stock D. DIP original experiment: DIP-217020X Nature structural & molecular biology 2010 IMEx The structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase. Lee LK., Stewart AG., Donohoe M., Bernal RA., Stock D. Only protein-protein interactions imex curation lee-2010-10 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lee LK., Stewart AG., Donohoe M., Bernal RA., Stock D. DIP original experiment: DIP-217021X Nature structural & molecular biology 2010 IMEx The structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase. Lee LK., Stewart AG., Donohoe M., Bernal RA., Stock D. Only protein-protein interactions imex curation lee-2010-11 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lee LK., Stewart AG., Donohoe M., Bernal RA., Stock D. DIP original experiment: DIP-217022X Nature structural & molecular biology 2010 IMEx The structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase. Lee LK., Stewart AG., Donohoe M., Bernal RA., Stock D. Only protein-protein interactions imex curation q5sit5_thet8 TTHA1279 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MTGGLVLNAISRAGGAMGGLGLIKSLAEKEKQLLERLEAAKKEAEERVKRAEAEAKALLEEAEAKAKALEAQYRERERAETEALLARYRERAEAEAKAVREKAMARLDEAVALVLKEVLP vate_thet8 V-type ATP synthase subunit E atpE V-ATPase subunit E vatE TTHA1276 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSKLEAILSQEVEAEIQALLQEAEAKAEAVKREAEEKAKALLQARERALEAQYRAALRRAESAGELLVATARTQARGEVLEEVRRRVREALEALPQKPEWPEVVRKLALEALEALPGAKALVANPEDLPHLEALARERGVELQAEPALRLGVRAVGAEGKTQVENSLLARLDRAWDALSSKVAQALWG q5sit5_thet8-atpe-1 3205050 N/A 3205053 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3205054 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false atpe-q5sit5_thet8-1 3205051 N/A 3205053 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3205054 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false atpe-q5sit5_thet8-2 3205052 N/A 3205053 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3205054 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false